Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate AZOBR_RS19475 AZOBR_RS19475 methionine ABC transporter ATP-binding protein
Query= TCDB::Q9HT70 (335 letters) >FitnessBrowser__azobra:AZOBR_RS19475 Length = 354 Score = 327 bits (839), Expect = 2e-94 Identities = 179/343 (52%), Positives = 235/343 (68%), Gaps = 10/343 (2%) Query: 1 MIEFHDVHKTY--RVAGREIPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPS 58 MI F + KTY R G+ + AL L I G+I+G+IG SGAGKSTLLR +N LE+P+ Sbjct: 1 MITFEQLQKTYPSRGTGQPVQALADIDLTIGRGEIYGIIGRSGAGKSTLLRTVNLLEKPT 60 Query: 59 GGRILVEGEDVTALDAEGLRRFRQRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEV 118 GR+LV+G DVTAL A LR R +GMIFQHFNLLSS+TV DN+A+PL LAG ++A++ Sbjct: 61 SGRVLVDGVDVTALSARELREARHSIGMIFQHFNLLSSRTVFDNVALPLELAG-VAKAQI 119 Query: 119 DARVSELLARVGLSDHARKYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTA 178 A V LL VGL+D +YPA+LSGGQKQRVGIARALA +P +LL DEATSALDP+TT Sbjct: 120 RATVEPLLDLVGLTDKRDRYPAELSGGQKQRVGIARALASKPKVLLSDEATSALDPETTT 179 Query: 179 SVLQLLAEINRELKLTIVLITHEMDVIRRVCDQVAVMDGGAIVEQGDVADVFLHPQHPTT 238 +L LLA+IN+ L LTIVLITHE+ VI+ +C +VAVM+ G I+EQG V D+F HP+H TT Sbjct: 180 QILHLLADINKRLGLTIVLITHEIAVIKEICHKVAVMENGRIIEQGPVFDIFAHPKHETT 239 Query: 239 RRF---VFEAERVDEDERHDDFAHVPG--LILRLTFRGEATYAPLLGTVARQTGVDYSIL 293 + F V D VPG ++LR+TF GE +P++ ++R+ +D +I Sbjct: 240 KTFVDPVINRGIPDSLRARLSATPVPGSNMVLRITFTGERATSPVISAISRKLNLDLNIW 299 Query: 294 SGRIDRIKDTPYGQLTLALVGG--DLEAAMSQLNAADVHVEVL 334 G+ID I+ P+G L + +G +EAA+S LN + VEVL Sbjct: 300 HGQIDEIQGAPFGTLVVEAIGNPQSIEAAISLLNVNKLGVEVL 342 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 354 Length adjustment: 29 Effective length of query: 306 Effective length of database: 325 Effective search space: 99450 Effective search space used: 99450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory