Align ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 2 (characterized)
to candidate AZOBR_RS08665 AZOBR_RS08665 amino acid ABC transporter permease
Query= reanno::Smeli:SMc02120 (384 letters) >FitnessBrowser__azobra:AZOBR_RS08665 Length = 367 Score = 339 bits (869), Expect = 8e-98 Identities = 185/376 (49%), Positives = 240/376 (63%), Gaps = 14/376 (3%) Query: 9 VRASMIEASPAPSLESGAVSWLRKNLFATPKDTALTIISLLILAWLVPPAIQWLFIDAAW 68 V I P+ G V+WLR NLF T + LTI+ +L +PP + WL A Sbjct: 5 VHTGSIPDERPPANTVGPVAWLRNNLFNTWYNALLTILIAWLLFKAIPPLLDWLIFSANS 64 Query: 69 SGGGRGVCATLSQGGSQPEGWSGACWAFVNAKFAQFLFGRYPLDERWRPALVGILFVLLL 128 G VC + EG GACW FV+ K +FG +P DE+WRP L+ I+ ++ L Sbjct: 65 FGTPPQVC--------RQEG--GACWTFVSEKLRFVMFGTFPYDEQWRP-LITIVIIIAL 113 Query: 129 VPMLIPRIPYKGLNALLLLVALPILSAILLPGGWFGLTYVETPLWGGLMVTLVLSFVGIA 188 V R +K AL+ + L + +L+ GG GLTYVE LWGGL +TL+LS VG++ Sbjct: 114 VLASCDRRFWKPWLALVWIAGLTAVG-VLMWGGVLGLTYVENTLWGGLPLTLMLSVVGLS 172 Query: 189 VSLPLGILLALGRRSNMPVIKMLCTVFIEVIRGVPLITVLFMASVMLPLFLPQGVTFDKF 248 V+ P +LLALGRRS +P I+++ +IE+IRGVPLI++LFMASVM PLFLP GV FDK Sbjct: 173 VAFPASVLLALGRRSQLPAIRVISVTYIELIRGVPLISLLFMASVMFPLFLPTGVNFDKL 232 Query: 249 LRALIGVSLFASAYMAEVVRGGLQAIPKGQYEGADSLGLSFWQKMGFIVLPQALKLVIPG 308 LRA I +FA+AYMAE +RGGLQAIPKGQYE AD+LGL++WQ MG I+LPQAL + IP Sbjct: 233 LRAQIAFIMFAAAYMAEAIRGGLQAIPKGQYEAADALGLNYWQAMGKIILPQALAISIPP 292 Query: 309 IVNTFIGLFKDTSLVSIIGMFDLLGIVRLNFSDTNWATAVTPLTGLIFAGFVFWLFCFGM 368 +VNTFI FKDTSLV IIG++DLLG + SD W +F G ++W+FC+ M Sbjct: 293 LVNTFISFFKDTSLVIIIGLYDLLGTAKAALSDPAWRGFYR--EAYLFIGVIYWVFCYSM 350 Query: 369 SRYSGFMERLLDRSQR 384 S+YS +ER L R R Sbjct: 351 SKYSQKLERDLRRGHR 366 Lambda K H 0.329 0.144 0.454 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 511 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 367 Length adjustment: 30 Effective length of query: 354 Effective length of database: 337 Effective search space: 119298 Effective search space used: 119298 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory