Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate AZOBR_RS00690 AZOBR_RS00690 ATP-binding protein
Query= TCDB::P73721 (252 letters) >FitnessBrowser__azobra:AZOBR_RS00690 Length = 268 Score = 263 bits (671), Expect = 4e-75 Identities = 141/256 (55%), Positives = 184/256 (71%), Gaps = 9/256 (3%) Query: 2 TSPTAP-LISFDQLQKNFGALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPI 60 T+P AP + + + K FG L+VL+GV+ DVI++IG SG GKST LRC+N LE Sbjct: 7 TNPNAPEAVLVENVHKRFGPLEVLKGVSLTAREGDVITLIGSSGSGKSTLLRCINMLEVP 66 Query: 61 SGGRLEVAG--VDLSGAK------IDQKHLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAP 112 GR+ + G + L A+ D + + ++R R+GMVFQ FNL+ H+T+L+N++ AP Sbjct: 67 DEGRIVIGGEAIGLKKARGGQTVPADSRQVDRIRTRLGMVFQSFNLWTHMTILENVIEAP 126 Query: 113 RKVLRIPMAEAKDRALTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDE 172 VL +P AEA DRA LDKVG+ KA++YP QLSGGQ+QR AIAR L M+P+++LFDE Sbjct: 127 VHVLGVPKAEAVDRARKLLDKVGILAKAESYPVQLSGGQQQRAAIARALAMQPKVMLFDE 186 Query: 173 PTSALDPELVGEVLNVMKQLAEEGMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNE 232 PTSALDPELVGEVL V++QLAEEG TM +VTHEM FAREV++ V F +QG IEE G P+ Sbjct: 187 PTSALDPELVGEVLLVIRQLAEEGNTMILVTHEMGFAREVASEVVFLHQGRIEERGPPDR 246 Query: 233 VFRNPKSDRLRAFLSR 248 V NP+SDR+R FLSR Sbjct: 247 VLVNPESDRVRQFLSR 262 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 268 Length adjustment: 24 Effective length of query: 228 Effective length of database: 244 Effective search space: 55632 Effective search space used: 55632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory