Align 3-ketoacyl-CoA thiolase (EC 2.3.1.16) (characterized)
to candidate AZOBR_RS28180 AZOBR_RS28180 acetyl-CoA acetyltransferase
Query= reanno::acidovorax_3H11:Ac3H11_2994 (397 letters) >FitnessBrowser__azobra:AZOBR_RS28180 Length = 397 Score = 501 bits (1291), Expect = e-146 Identities = 248/389 (63%), Positives = 305/389 (78%) Query: 7 DPIVIVGAARTPMGSLQGDFSSLAAHDLGGAAIKAAIERAGVSPDAVGEVLFGNCLMAGQ 66 DP+VIV AARTP+G QG+ S+L AH LG A++AA+ RAG++P+ V EVL G L AGQ Sbjct: 6 DPVVIVSAARTPLGRFQGELSALPAHALGAHAVRAALSRAGLAPERVDEVLLGCVLPAGQ 65 Query: 67 GQAPARQAAFKGGLPKGAGAVTLSKMCGSGMKAAMMAHDMLLAGSHDVMVAGGMESMTNA 126 GQAPARQAA GLP GA T++K+CGSGMKA M+AHD++ AGS D++VAGGMESM+NA Sbjct: 66 GQAPARQAARGAGLPDATGATTVNKVCGSGMKATMLAHDLIRAGSADLVVAGGMESMSNA 125 Query: 127 PYLLQKGRGGYRLGHDRIFDHMMLDGLEDAYEAGRSMGTFGEDCAAKYSFTREQQDAFAT 186 PYLL K RGGYR+GHDRI DH+MLDGLEDAYE GR MG FGE A Y FTR +QDA+A Sbjct: 126 PYLLAKARGGYRIGHDRILDHLMLDGLEDAYEGGRPMGDFGEATADLYGFTRAEQDAYAV 185 Query: 187 ASVQRAKAATESGAFAAEIVPVTVKTRAGETVVSVDEGPGKVKLEKIATLKPAFKKDGTI 246 ++ RA+AA SGAF AEI PVT+ + GE V+ DE P KV EKI LKPAF++DGTI Sbjct: 186 ETLTRARAAIASGAFTAEIAPVTLAVKGGERTVADDENPLKVAPEKIPALKPAFRRDGTI 245 Query: 247 TAASSSSINDGAAALVMMRESTAKKLGAKPLARIVSHATHAQEPEWFATAPLGATQKALA 306 TAASSS+ DGAAAL++ R S A++ G LA I+ HATH+Q+P WF TAP+ A +K L Sbjct: 246 TAASSSANADGAAALLLTRRSLAEREGLPVLATILGHATHSQDPAWFTTAPIPAIRKLLD 305 Query: 307 KAGWQVGDVQLWEINEAFAVVPMALMKELDLPHDKVNVNGGACALGHPIGASGARIMVTL 366 + GW +GDV L+EINEAFAVV MA ++L +P D +NVNGGACALGHPIGA+GAR++VTL Sbjct: 306 RVGWGIGDVDLFEINEAFAVVAMAAQRDLGIPRDALNVNGGACALGHPIGATGARLIVTL 365 Query: 367 IHALKARGLTKGLATLCIGGGEATAVALE 395 +HAL ARGL +G+A+LCIGGGEATA+A+E Sbjct: 366 LHALAARGLRRGVASLCIGGGEATAIAVE 394 Lambda K H 0.317 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 530 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 397 Length adjustment: 31 Effective length of query: 366 Effective length of database: 366 Effective search space: 133956 Effective search space used: 133956 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate AZOBR_RS28180 AZOBR_RS28180 (acetyl-CoA acetyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.17332.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-126 408.7 2.4 1.4e-126 408.5 2.4 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS28180 AZOBR_RS28180 acetyl-CoA acetylt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS28180 AZOBR_RS28180 acetyl-CoA acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 408.5 2.4 1.4e-126 1.4e-126 1 385 [] 10 394 .. 10 394 .. 0.97 Alignments for each domain: == domain 1 score: 408.5 bits; conditional E-value: 1.4e-126 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageqaniaReaalaag 69 iv+a+Rtp g+++g l+ l+a+ L+a++++++l ragl pe++dev lG+vl+ag+++++aR+aa ag lcl|FitnessBrowser__azobra:AZOBR_RS28180 10 IVSAARTPLGRFQGELSALPAHALGAHAVRAALSRAGLAPERVDEVLLGCVLPAGQGQAPARQAARGAG 78 8******************************************************************** PP TIGR01930 70 lpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakled 138 lp+ + a+tvn+vC+Sg++A +la + i+aG ad+vvaGG+EsmS++p+ll ++ r ++++g+ + d lcl|FitnessBrowser__azobra:AZOBR_RS28180 79 LPDATGATTVNKVCGSGMKATMLAHDLIRAGSADLVVAGGMESMSNAPYLLAKA--RGGYRIGHDRILD 145 ***************************************************997..89*********** PP TIGR01930 139 qllkdl....vktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk.. 201 +l+ d+ + + +mg e +a+ yg++R eqD+ya++ ++a +Ai++g f +ei pv++ k lcl|FitnessBrowser__azobra:AZOBR_RS28180 146 HLMLDGledaYEGGRPMGDFGEATADLYGFTRAEQDAYAVETLTRARAAIASGAFTAEIAPVTLAVKgg 214 99988899998999**************************************************99997 PP TIGR01930 202 kkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplariv 270 +++v++De++ ++ ek+ Lkpaf++ +g t+tA++ss +DGAaalll+ ++ a++ gl +la+i lcl|FitnessBrowser__azobra:AZOBR_RS28180 215 ERTVADDENPL-KVAPEKIPALKPAFRR-DG-TITAASSSANADGAAALLLTRRSLAEREGLPVLATIL 280 77766666665.99************96.9*.6************************************ PP TIGR01930 271 saavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAi 339 ++a+ + dp+ ++++p+pAi+k+L++ g+ i d+dl+EinEAFA++++a++++lg + ++ +NvnGGA lcl|FitnessBrowser__azobra:AZOBR_RS28180 281 GHATHSQDPAWFTTAPIPAIRKLLDRVGWGIGDVDLFEINEAFAVVAMAAQRDLG-IPRDALNVNGGAC 348 *******************************************************.88*********** PP TIGR01930 340 AlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 AlGHP+Ga+Gar+++tll++L+ rg ++G+a+lC+ggG ++A+ +e lcl|FitnessBrowser__azobra:AZOBR_RS28180 349 ALGHPIGATGARLIVTLLHALAARGLRRGVASLCIGGGEATAIAVE 394 ******************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (397 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.54 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory