Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate AZOBR_RS24695 AZOBR_RS24695 3-oxoacyl-ACP reductase
Query= BRENDA::Q99714 (261 letters) >FitnessBrowser__azobra:AZOBR_RS24695 Length = 256 Score = 105 bits (263), Expect = 7e-28 Identities = 91/259 (35%), Positives = 127/259 (49%), Gaps = 27/259 (10%) Query: 6 RSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADV 65 R + G VA +TGG G+G A ERL +GA+ V+ D+ E A L A A Sbjct: 9 RRLAGRVAFVTGGGGGIGRAVCERLAAEGAAVVVADIGAEVAETVAAALRAEGAQAHATA 68 Query: 66 TSEKDVQTALALAKG---KFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNL 122 + D ++ A G F VD+ VN AGI + +L K T ++ V+DVNL Sbjct: 69 LNVADRESWGAAVTGLPEAFRGVDIMVNVAGIV---RDRSLPK---MTDAEWSAVIDVNL 122 Query: 123 MGTF----NVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGM 178 GT+ RLV D+G R I+N AS A G GQA YSASK G+VG+ Sbjct: 123 RGTWLGCQTAFRLVG--------DRGWGR--IVNIASTAIL-GTFGQANYSASKAGVVGL 171 Query: 179 TLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQ 238 T A + A GI V +APG+ T ++ +P+ V + + P RLG PAE A +V Sbjct: 172 TRTAALEGARRGILVNAVAPGVVETAIVEGVPDAVRSQWLEKTPI-GRLGKPAEIAAVVA 230 Query: 239 AIIEN--PFLNGEVIRLDG 255 + + ++ G+ I DG Sbjct: 231 FLASDDAAYVTGQTIVADG 249 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 256 Length adjustment: 24 Effective length of query: 237 Effective length of database: 232 Effective search space: 54984 Effective search space used: 54984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory