Align acyl CoA carboxylase biotin carboxylase subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate AZOBR_RS12015 AZOBR_RS12015 acetyl-CoA carboxylase biotin carboxylase subunit
Query= metacyc::MONOMER-13597 (509 letters) >FitnessBrowser__azobra:AZOBR_RS12015 Length = 447 Score = 397 bits (1019), Expect = e-115 Identities = 210/445 (47%), Positives = 292/445 (65%), Gaps = 5/445 (1%) Query: 4 FSRVLVANRGEIATRVLKAIKEMGMTAIAVYSEADKYAVHTKYADEAYYIGKAPALDSYL 63 F +VL+ANRGEIA R+ +A +EMG+ +AV+S AD A+H + ADE+ IG A A +SYL Sbjct: 2 FEKVLIANRGEIALRIHRACREMGIQTVAVHSTADADAMHVRLADESVCIGPASARESYL 61 Query: 64 NIEHIIDAAEKAHVDAIHPGYGFLSENAEFAEAVEKAGITFIGPSSEVMRKIKDKLDGKR 123 NI I+ AA DAIHPG GFLSENA+FAE VE+ G TFIGP++E +R + DK+ K+ Sbjct: 62 NIPAILSAASITGADAIHPGIGFLSENAQFAEMVEEHGFTFIGPTAEHIRIMGDKVTAKK 121 Query: 124 LANMAGVPTAPGSDGPVTSIDEALKLAEKIGYPIMVKAASGGGGVGITRVDNQDQLMDVW 183 G+P PGSDGPV +++EA K+ + GYPI++KAA+GGGG G+ N DQL + + Sbjct: 122 TVMEQGLPVVPGSDGPVPTLEEAEKIGRETGYPILIKAAAGGGGKGMKVARNPDQLKEAY 181 Query: 184 ERNKRLAYQAFGKADLFIEKYAVNPRHIEFQLIGDKYGNYVVAWERECTIQRRNQKLIEE 243 + + A AFG +++IEKY PRHIE QL+GD++GN V ER+C++QRR+QK+IEE Sbjct: 182 QLARGEARAAFGNDEVYIEKYLGKPRHIEIQLLGDEHGNCVHFGERDCSVQRRHQKVIEE 241 Query: 244 APSPALKMEERESMFEPIIKFGKLINYFTLGTFETAFSDVSRDFYFLELNKRLQVEHPTT 303 APSPAL E+R + + K I Y +GT E F D FYF+E+N RLQVEH T Sbjct: 242 APSPALNAEQRAFIGDLAAKTAAAIGYRGVGTMEFLFED--GQFYFIEMNTRLQVEHTIT 299 Query: 304 ELIFRIDLVKLQIKLAAGEHLPFSQEDLNKRVRGTAIEYRINAEDALNNFTGSSGFVTYY 363 E+I IDLV+ QI++A G L + Q D+ R +G +IE R+NAE F S G + Y Sbjct: 300 EMITGIDLVREQIRVATGAPLGYGQADI--RFQGHSIECRVNAEHP-ETFIPSPGKIDGY 356 Query: 364 REPTGPGVRVDSGIESGSYVPPYYDSLVSKLIVYGESREYAIQAGIRALADYKIGGIKTT 423 P G GVRVDS + G +PP+YDSL++KL+V+G +R + R + +Y IGG+ TT Sbjct: 357 HAPGGLGVRVDSALYDGYRIPPHYDSLIAKLVVHGTTRNECLMRLRRTIEEYVIGGVDTT 416 Query: 424 IELYKWIMQDPDFQEGKFSTSYISQ 448 + L++ I+ F +G + ++ Q Sbjct: 417 LPLHQRIIAQQAFIDGNYDIHWLEQ 441 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 581 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 447 Length adjustment: 33 Effective length of query: 476 Effective length of database: 414 Effective search space: 197064 Effective search space used: 197064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory