Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate AZOBR_RS09095 AZOBR_RS09095 NAD-dependent dehydratase
Query= curated2:Q56623 (328 letters) >FitnessBrowser__azobra:AZOBR_RS09095 Length = 317 Score = 223 bits (567), Expect = 6e-63 Identities = 128/318 (40%), Positives = 187/318 (58%), Gaps = 15/318 (4%) Query: 12 ILLTGSTGFVGTNLVKSLTLKSDYIVKSAVR-------HAVNKDDGLLFEVGDINASTDF 64 +L+TG+TGFV ++ L ++ + V++ VR HA + +GDI +T + Sbjct: 3 VLVTGATGFVARTVIP-LLVERGHSVRAVVRRPDIPVPHAADT-----VTIGDIGPATAW 56 Query: 65 ELPLKNTTVVVHCAARAHVMDDKEAEPLTLYREVNTAGTVNLAKQAIDSGVKRFIFISSI 124 L+ VVH AAR HVM D+E++PL +R VNTAGT LA+ A +GVKR +++SS+ Sbjct: 57 GNALQGMDAVVHLAARVHVMRDRESDPLAAFRRVNTAGTRVLAEAAAAAGVKRMVYLSSV 116 Query: 125 KVNGEGTLVGCPFKTEDNHAPEDDYGLSKSEAEKQLVALAKDSSMEVVIIRPTIVYGPGV 184 K + + E P YG+SK EAE+ L ++ + +E V+IRP +VYGPGV Sbjct: 117 KALADESRPD-ELSEETEPDPHSPYGISKLEAERALAEISARTGLEAVVIRPPLVYGPGV 175 Query: 185 KANFASLMRLVSKGIPLPFGSITQNKRSLVSINNLVDLIVTCIDHPKAANQVFLVSDGHD 244 NF LM+ V +GIPLP G++ +N+RSL+ + NL D I C+ HP+AA FLV DG Sbjct: 176 GGNFLRLMQAVDRGIPLPLGAL-ENRRSLIFVGNLADAIQECLTHPQAAGGRFLVHDGRP 234 Query: 245 VSTAEMVRELAIALDKPTWQLPVPIWCYKLFGKLFGKSDIVDRLTGTLQVDISHTKETLG 304 +STAE+VR +A AL KP LPVP L +L + ++DR+ G+L +D + L Sbjct: 235 MSTAELVRAIAEALGKPARLLPVPPSLLALAARLARREAMLDRVAGSLVIDDGAIRRALN 294 Query: 305 WKPPQTLQEGFKQTAQAF 322 W+PP G + TA+ F Sbjct: 295 WRPPCYPAYGLRLTAEWF 312 Lambda K H 0.318 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 317 Length adjustment: 28 Effective length of query: 300 Effective length of database: 289 Effective search space: 86700 Effective search space used: 86700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory