Align UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate AZOBR_RS33705 AZOBR_RS33705 flagellin modification protein FlmA
Query= SwissProt::Q9ZDJ5 (341 letters) >FitnessBrowser__azobra:AZOBR_RS33705 Length = 330 Score = 197 bits (501), Expect = 3e-55 Identities = 125/310 (40%), Positives = 175/310 (56%), Gaps = 11/310 (3%) Query: 1 MFVDKTLMITGGTGSFGNAVLSRFLKSNIINDIKEIRIFSRDEKKQEDMRIALNN---SK 57 M +++++TGG+GSFG + L+ + + +FSRDE KQ +M+ L S Sbjct: 1 MLNGQSILVTGGSGSFGKRFVETVLRHA---SPRRVIVFSRDEFKQYEMQQQLGPDWAST 57 Query: 58 LKFYIGDVRNYQSIDDAMHGVDYVFHAAALKQVPTCEFYPMEAINTNVLGAENVLSAAIN 117 L+F+IGDVR+ + ++ AM VD HAAALK VP E+ PME I+TNV GAENV+ AA+N Sbjct: 58 LRFFIGDVRDRERLELAMREVDVCVHAAALKHVPAAEYNPMECIHTNVYGAENVVRAALN 117 Query: 118 NKVTKVIVLSTDKAVYPINAMGLSKALMEKLAIAKARMRSPGETILCVTRYGNVMASRGS 177 V +VI LSTDKA P+N G SK +K+ IA + T V RYGNV+ SRGS Sbjct: 118 TGVKRVIALSTDKAANPVNLYGASKLASDKIFIAANNLSGSLGTRFSVVRYGNVVGSRGS 177 Query: 178 VIPLFIHQIKQGKE-LTITEPSMTRFLMSLVDSVDLVLYAFEHGRQGDIFVQKSPASTIE 236 VIPLF I +G E L +T+ MTRF ++L VD V+ + G+IFV K P+ I Sbjct: 178 VIPLFRRMIAEGAESLPVTDDRMTRFWITLQHGVDFVVSCIAMMQGGEIFVPKIPSMRIT 237 Query: 237 VLAKALQEIFGSKNAIRFIGTRHGEKHYESLVSSEDMAKADDLGGYYRIPMDGRDLNYAK 296 LA+A+ K +G R GEK +E +++ +D + +L + I + Sbjct: 238 DLARAMAPHLPHKQ----VGIRPGEKLHEVMITEDDSRQTFELPDRFVIEPAFAFWTHEP 293 Query: 297 YFVTGEKKVA 306 Y G K VA Sbjct: 294 YQRLGAKPVA 303 Lambda K H 0.319 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 330 Length adjustment: 28 Effective length of query: 313 Effective length of database: 302 Effective search space: 94526 Effective search space used: 94526 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory