Align Gluconolactonase (characterized, see rationale)
to candidate AZOBR_RS31230 AZOBR_RS31230 gluconolactonase
Query= uniprot:A0A165IRV8 (316 letters) >FitnessBrowser__azobra:AZOBR_RS31230 Length = 299 Score = 196 bits (498), Expect = 6e-55 Identities = 118/295 (40%), Positives = 156/295 (52%), Gaps = 8/295 (2%) Query: 25 VRCVIALGNALGEGVLWSVREQAVYWVDILGRELHRWDPATGAHQRWTFDEEISAIAERA 84 VRCV LGEG LWS + AV++VDI G + R G+ W ++ + E A Sbjct: 5 VRCVWPARALLGEGPLWSPEQGAVFFVDIHGSRILRHGLDDGSQADWALEDAACWLVECA 64 Query: 85 HAPGFIVTLRRGFAL---FDPATDMAPRYLHQPEPDRAGNRFNDGKCDAQGRFWAGSMDF 141 GFI LR + +P + L + +PDR GNR ND K DAQGR W GSMD Sbjct: 65 DGDGFIAGLRSRRVVRLRLEPGRAVIAGELARIDPDRPGNRLNDAKADAQGRLWIGSMDD 124 Query: 142 ACEAPTGALYRYDSDGSCTRHDDGFAVTNGPTWSGTGQGAAMFFNATIEGNTYRYDSDLA 201 E P+GA +R D DGS TR D+G+ V NGP S G+ ++ + + +D D Sbjct: 125 GEETPSGAFHRLDPDGSITRMDEGYTVANGPALSPDGR--TLYHTDSAARTIHAFDLD-G 181 Query: 202 TGTVSNKTLWKHWLPEDGLPDGMTTDAQGRLWIAHWGGWCVTCHDPVTAAELGRVRLPVS 261 G +S K + DG PDGMT DA+G LW+AHW G V+ P + + LPVS Sbjct: 182 AGRLSGKRAHIRFAEADGYPDGMTCDAEGGLWVAHWDGGRVSRFRPDGTLDRA-IALPVS 240 Query: 262 QVTTCAFGGADLRTLFISSARVGLTPEQLAAEPLAGALFAVDTDSL-GLPAHPFG 315 +VT+C F G L LF+++A G+ + EPLAGALF D + GLP FG Sbjct: 241 RVTSCVFAGPALDRLFVTTAAHGIGRDGRPDEPLAGALFECDPGGVRGLPPGRFG 295 Lambda K H 0.321 0.137 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 473 Number of extensions: 40 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 299 Length adjustment: 27 Effective length of query: 289 Effective length of database: 272 Effective search space: 78608 Effective search space used: 78608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory