Align β-glycosidase (β-gly) (EC 3.2.1.21|3.2.1.23) (characterized)
to candidate AZOBR_RS26075 AZOBR_RS26075 beta-glucosidase
Query= CAZy::ABI35984.1 (431 letters) >FitnessBrowser__azobra:AZOBR_RS26075 Length = 444 Score = 366 bits (939), Expect = e-106 Identities = 196/436 (44%), Positives = 260/436 (59%), Gaps = 12/436 (2%) Query: 6 EKFLWGVATSAYQIEGATQEDGRGPSIWDAFARRPGAIRDGSTGEPACDHYRRYEEDIAL 65 E FLWG +TSA+Q+EGA EDGR PSIWD+F R G + +G TG+ ACDHY RY ED+AL Sbjct: 9 EGFLWGTSTSAFQVEGAATEDGRAPSIWDSFCRLKGRVDNGDTGDVACDHYHRYAEDVAL 68 Query: 66 MQSLGVRAYRFSVAWPRILPEGRGRINPKGLAFYDRLVDRLLASGITPFLTLYHWDLPLA 125 M+ LGV AYRFSVAWPR+LP GRG N GL FYDRL+D +L +GI P+L +YHWDLP A Sbjct: 69 MRGLGVDAYRFSVAWPRVLPRGRGMANEAGLDFYDRLIDTVLEAGIEPWLCVYHWDLPQA 128 Query: 126 LEERGGWRSRETAFAFAEYAEAVARALADRVPFFATLNEPWCSAFLGHWTGEHAPGLRNL 185 L++ GGW +R++A +A+Y +AR DRV + T NE G+ APG+ + Sbjct: 129 LQDLGGWANRDSAGWYADYTTLLARRYGDRVKRWITFNEFSVFTLFGYAIPWAAPGITDR 188 Query: 186 EAALRAAHHLLLGHGLAVEALRA-AGARRVGIVLN---FAPAYG--EDPEAVDVADRYHN 239 LRA HH+ L HG V+A+RA +G V N P G E+ EA + D + N Sbjct: 189 GQHLRAIHHVNLAHGAGVDAVRALVPGASIGAVHNRQRVLPEGGKPENAEAAALLDEHWN 248 Query: 240 RYFLDPILGKGYPESPFRDPPPVPILSRDLELVARPLDFLGVNYYAPV--RVAPGTGTLP 297 F DP L YP R P + + D+ + RP+D+ G+N+Y P+ RV P T T Sbjct: 249 LAFCDPQLLGHYPPRVARAIEPC-VKAGDMARICRPMDWFGLNHYGPIFARVNPET-TWG 306 Query: 298 VRY--LPPEGPATAMGWEVYPEGLHHLLKRLGREVPWPLYVTENGAAYPDLWTGEAVVED 355 + PP+ P +GW V+P+ L + R P+ +TENG D + D Sbjct: 307 YGWGDAPPDSPTHGVGWAVFPDAFRDELLEITRRYRMPIVITENGCGGSDSPDESGDIVD 366 Query: 356 PERVAYLEAHVEAALRAREEGVDLRGYFVWSLMDNFEWAFGYTRRFGLYYVDFPSQRRIP 415 R+ YL+ + + A G D+RGYFVWSL+DNFEW GY RFG+ +VDF SQ+R P Sbjct: 367 QHRINYLQLYNASMHEAIRGGADVRGYFVWSLLDNFEWGSGYGNRFGIVHVDFESQKRTP 426 Query: 416 KRSALWYRERIARAQT 431 K SA WY + I RA++ Sbjct: 427 KASARWYADLIKRARS 442 Lambda K H 0.322 0.140 0.453 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 684 Number of extensions: 33 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 431 Length of database: 444 Length adjustment: 32 Effective length of query: 399 Effective length of database: 412 Effective search space: 164388 Effective search space used: 164388 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory