Align 2-keto-isovalerate dehydrogenase component α subunit (EC 1.2.4.4) (characterized)
to candidate AZOBR_RS22245 AZOBR_RS22245 pyruvate dehydrogenase E1 subunit alpha
Query= metacyc::MONOMER-11683 (330 letters) >FitnessBrowser__azobra:AZOBR_RS22245 Length = 338 Score = 157 bits (397), Expect = 4e-43 Identities = 109/311 (35%), Positives = 163/311 (52%), Gaps = 10/311 (3%) Query: 14 QEAVDMYRTMLLARKIDERMWLLNRSGKIP-FVISCQGQEAAQVGAAFALDREMDYVLPY 72 ++ + YR MLL R+ +E+ L G I F GQEA VG AL ++ D V+ Sbjct: 23 EDLIKYYREMLLIRRFEEKAGQLYGMGLIGGFCHLYIGQEAVVVGIQAAL-KDNDDVITS 81 Query: 73 YRDMGVVLAFGMTAKDLM--MSGFAKAADPNSGGRQMPGHFGQKKNRIVTGSSPVTTQVP 130 YRD G +LA GM K +M ++G GG H ++ G V QVP Sbjct: 82 YRDHGHMLACGMDPKGVMAELTGRRGGYSKGKGGSM---HMFSREKNFYGGHGIVGAQVP 138 Query: 131 HAVGIALAGRMEKKDIAAFVTFGEGSSNQGDFHEGANFAAVHKLPVIFMCENNKYAISVP 190 G+A + + K D + V G+G+ NQG +E N AA+ KLPV+++ ENNKYA+ Sbjct: 139 LGTGLAFSHKYNKDDGLSAVYCGDGAINQGQVYESFNMAALWKLPVLYVIENNKYAMGTS 198 Query: 191 YDKQVACENISDRAIGYGMPGVTVNGNDPLEVYQAVKEARERARRGEGPTLIETISYRLT 250 ++ A E + R YG+PG VNG D LEV +A + E R G GP ++E +YR Sbjct: 199 QERASAGE-LHQRGAAYGIPGHQVNGMDVLEVREAADKWVEYIRAGNGPVILEMKTYRYR 257 Query: 251 PHSSDDDDSSYRGREEVEEAK-KSDPLLTYQAYLKETGLLSDEIEQTMLDEIMAIVNEAT 309 HS D + YR +EEVE+ + +SDP+ + L E ++++ + + E+ A+V EA Sbjct: 258 GHSM-SDPAKYRTKEEVEKMRSESDPIDNLKRVLLEGAYVTEDQLKEIDREVKAVVTEAA 316 Query: 310 DEAENAPYAAP 320 + A+ +P P Sbjct: 317 EFAQQSPEPDP 327 Lambda K H 0.316 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 338 Length adjustment: 28 Effective length of query: 302 Effective length of database: 310 Effective search space: 93620 Effective search space used: 93620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory