Align branched-chain-2-oxoacid decarboxylase (subunit 2/2) (EC 4.1.1.72) (characterized)
to candidate AZOBR_RS04800 AZOBR_RS04800 pyruvate dehydrogenase subunit beta
Query= BRENDA::Q9HIA4 (319 letters) >FitnessBrowser__azobra:AZOBR_RS04800 Length = 343 Score = 269 bits (687), Expect = 8e-77 Identities = 154/332 (46%), Positives = 204/332 (61%), Gaps = 17/332 (5%) Query: 1 MNMVQALNSAMDLKMSEDDSVIILGEDV-------GRD---GGVFRVTDGLQAKYGPQRV 50 ++M A+N A+DL+M D +VI++GED+ G D GGV VT GL AK+G R+ Sbjct: 5 ISMKTAINEALDLEMRRDPTVILMGEDIVGGTGAPGEDDAWGGVLGVTKGLFAKHG-DRL 63 Query: 51 IDTPLSELGIVGMAIGMAVNGLKPIPEIQFQDFIYTSMDQIINQMAKIRYRSGGDYTVPL 110 +DTPLSE +G AIG A G++P+ E+ F DF+ DQI NQ AK RY GG P+ Sbjct: 64 LDTPLSESAYIGAAIGAATCGMRPVAELMFMDFMGVCFDQIFNQAAKFRYMFGGKAETPV 123 Query: 111 VLRTPVGGGIKGGLYHSQSGEAYFAHTAGLTVVSPSNPYDAKGLLISAIESPDPVIFLEP 170 V+R VG G + HSQ F H GL VV PSN YDAKGLLI +I DPVIF E Sbjct: 124 VIRGMVGAGFRAAAQHSQMLTPLFTHIPGLKVVCPSNAYDAKGLLIQSIRDNDPVIFCEH 183 Query: 171 KRLYRAQKVEVPDEKYTIPLRKANVLKQGNDVTIVTYGSMVPTVMSVA---SKSKYDVEV 227 K LY + EVP E Y IP +ANVL+ G+ VTIV+YG V M A +K K + EV Sbjct: 184 KNLY-GHETEVPAESYAIPFGEANVLRDGDHVTIVSYGLTVHRAMEAADALAKDKVEAEV 242 Query: 228 IDLRTIAPMDRDTIISSVKKTGRVVIVHEAPRTLGVGAEISAMISERAIEYLYAPIVRVT 287 IDLRT++P+D DTII SV++TGR+V+V EA + +ISA +++ A L + I VT Sbjct: 243 IDLRTLSPIDWDTIIDSVERTGRLVVVDEAHPRCNLATDISAFVAQNAFGALKSGIQMVT 302 Query: 288 GPDTPFPY--RLEEYYLPNEGRINAALDRVMS 317 P TP P+ LE+ Y+P+ + AA+ R ++ Sbjct: 303 PPHTPVPFSPSLEDLYIPSAEAVAAAVRRTLA 334 Lambda K H 0.318 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 13 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 343 Length adjustment: 28 Effective length of query: 291 Effective length of database: 315 Effective search space: 91665 Effective search space used: 91665 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory