Align Probable branched-chain-amino-acid aminotransferase; BCAT; EC 2.6.1.42 (uncharacterized)
to candidate AZOBR_RS14455 AZOBR_RS14455 D-amino acid aminotransferase
Query= curated2:P74921 (273 letters) >FitnessBrowser__azobra:AZOBR_RS14455 Length = 287 Score = 77.0 bits (188), Expect = 4e-19 Identities = 56/159 (35%), Positives = 86/159 (54%), Gaps = 9/159 (5%) Query: 109 LETGVEVKISNVRRIPDLSTPPA-LKITGRTDIVLARREIVD--CYDVILLGLNGQVCEG 165 LE GV V +PD+ +K G VLA+++ + Y+ L+ +G V EG Sbjct: 128 LEKGVAVVT-----VPDIRWGRCDIKTVGLLAPVLAKQQAAESGAYEAWLIDPDGTVTEG 182 Query: 166 SFSNVFLV-KEGKLITPSLDSGILDGITRENVIKLAKSLEIPVEERVVWVWELFEADEMF 224 S SN ++V ++G L+T + IL+GITR ++++LA IPVEER V E A E F Sbjct: 183 SSSNAWIVTQDGVLVTRAPSQKILNGITRLSLLRLAGERGIPVEERSFTVEEALAAREAF 242 Query: 225 LTHTSAGVVPVRRLNEHSFFEEEPGPVTATLMENFEPFV 263 ++ +PV R++ E +PGPVT TL + + +V Sbjct: 243 VSSAGTFALPVTRIDGKPVGEGKPGPVTRTLRQAYLDYV 281 Lambda K H 0.322 0.140 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 287 Length adjustment: 26 Effective length of query: 247 Effective length of database: 261 Effective search space: 64467 Effective search space used: 64467 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory