GapMind for catabolism of small carbon sources

 

Aligments for a candidate for liuB in Azospirillum brasilense Sp245

Align Methylcrotonoyl-CoA carboxylase (EC 6.4.1.4) (characterized)
to candidate AZOBR_RS21105 AZOBR_RS21105 acetyl-CoA carboxylase

Query= reanno::Smeli:SM_b21124
         (662 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS21105 AZOBR_RS21105 acetyl-CoA
           carboxylase
          Length = 666

 Score =  504 bits (1298), Expect = e-147
 Identities = 307/679 (45%), Positives = 400/679 (58%), Gaps = 53/679 (7%)

Query: 1   MFSKLLIANRGEIACRIIRTARRLGIRTVAVYSDADGDALHVALADEAIRIGGAPAAESY 60
           +FSK+LIANRGEIACR+IRTARRLGI+TVAVYSDAD +ALHV +ADEA+ IG AP+A+SY
Sbjct: 1   LFSKILIANRGEIACRVIRTARRLGIKTVAVYSDADRNALHVEMADEAVHIGAAPSAQSY 60

Query: 61  LASAPIVQAARSVGAQAIHPGYGFLSENADFAEAVAEAGMIFVGPPPAAIRAMGLKDAAK 120
           L    IV A +  GAQA+HPGYGFLSE  +F EA+A AG+ F+GP   AI+AMG K  +K
Sbjct: 61  LLIDRIVDACKKTGAQAVHPGYGFLSEKREFQEALAAAGIAFIGPDAHAIQAMGDKIESK 120

Query: 121 ALMERSGVPVVPGYHGEEQDASFLADRAREIGYPVLIKARAGGGGKGMRRVERQEDFGPA 180
            L + +GV  VPGY G   D S     AR+IGYPV+IKA AGGGGKGMR     E+    
Sbjct: 121 KLAKAAGVSTVPGYLGVIADDSEAVTIARDIGYPVMIKASAGGGGKGMRVAWNDEEAREG 180

Query: 181 LEAARREAESAFGDGSVLLERYLTKPRHIEMQVFGDRHGNIVHLFERDCSLQRRHQKVIE 240
             +A+ EA S+F D  V +E+Y+ +PRHIE+QV  D  G  ++L ER+CS+QRRHQKVIE
Sbjct: 181 FRSAQNEARSSFADDRVFVEKYIQQPRHIEIQVLADGQGTALYLGERECSIQRRHQKVIE 240

Query: 241 EAPAPGMTAEVRRAMGDAAVRAAQAIGYVGAGTVEFIADVTNGLWPDHFYFMEMNTRLQV 300
           EAP+P + A  R+AMG+ AV  A+A+ Y  AGTVEFI D        +FYF+EMNTRLQV
Sbjct: 241 EAPSPFLDAATRKAMGEQAVALARAVDYKSAGTVEFIVDAER-----NFYFLEMNTRLQV 295

Query: 301 EHPVTEAITGIDLVEWQLRVASGEPLPKKQADISMNGWAFEARLYAEDPARGFLPATGRL 360
           EHPVTE +TG+DLVE  +RVA+GE L  KQ DI ++GWA E+R+YAEDP R FLP+TGRL
Sbjct: 296 EHPVTELVTGLDLVELMIRVAAGEKLTLKQEDIHLHGWAIESRVYAEDPFRNFLPSTGRL 355

Query: 361 TELSFP--EGTSRVDSGVRQGDTITPYYDPLIAKLIVHGQNRSAALGRLQDALKECRIGG 418
           T    P  +   RVD+GV +G  I+ YYDP+IAKL   G  R AA+ R+++AL +  I G
Sbjct: 356 THYRPPSEDPHVRVDTGVYEGGEISMYYDPMIAKLCSWGSTRDAAIARMREALDQYYIRG 415

Query: 419 TVTNRDFLIRLTEEHDFRSGHPDTGLIDREIER-LTAPVAPGDEALALAAIFS------- 470
              N  FL  L     F  G   T  I  E      A   P +E   L A+ +       
Sbjct: 416 VSHNIPFLASLMANQRFVEGRLTTNFIAEEYPTGFHASDLPPEEPAVLIAVAAVIHRCLN 475

Query: 471 ------TGALDPN--RSTDPWSSLGSWQIWGDAHRMVV--IEHADVRATVTLASRGR--- 517
                 +G +  N  R  D W  +    + G  H + V   + +  R   T+   GR   
Sbjct: 476 DRDIQISGKMPGNKVRVRDDWVVV----MDGTQHPVHVRPTDGSPQRIGYTVDFEGRHHV 531

Query: 518 -------DQFAVRAGASTLPVLV-LDRFEGGARLEVAGQKRLIRFSRDREALTLFHGGRN 569
                   Q   R   +   V V +DR   G RL  +G + L++      A         
Sbjct: 532 VWSDWTLGQPLFRGTVNGAHVCVQVDRVGVGYRLSHSGSQALVKVLTPNAARL------- 584

Query: 570 LVFHVPDGLTGGQSSEIADDELVAPMPGLVKLVRVGAGDAVTKGQALVVMEAMKMELTLS 629
                 D L   ++       L++PMPGL+  V V  G  V  G+ L V+EAMKME  L 
Sbjct: 585 ------DALMPVKAPPDMSKFLLSPMPGLLVSVAVTEGQEVKAGEVLAVVEAMKMENILR 638

Query: 630 ASREGTIANVHVAEGAQVS 648
           A+++GT++ VH   G+ ++
Sbjct: 639 AAQDGTVSKVHATPGSSLA 657


Lambda     K      H
   0.319    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1133
Number of extensions: 52
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 662
Length of database: 666
Length adjustment: 38
Effective length of query: 624
Effective length of database: 628
Effective search space:   391872
Effective search space used:   391872
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory