Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate AZOBR_RS01260 AZOBR_RS01260 enoyl-CoA hydratase
Query= BRENDA::F4JML5 (301 letters) >FitnessBrowser__azobra:AZOBR_RS01260 Length = 258 Score = 161 bits (408), Expect = 1e-44 Identities = 90/239 (37%), Positives = 139/239 (58%), Gaps = 2/239 (0%) Query: 58 VNLDRPVTKNAINKEMLKSLQNAFESIHQDNSARVVMIRSLVPGVFCAGADLKERRTMSP 117 V L+RP NA++ ++ L A +++ D+S +++ F AGAD+KE + S Sbjct: 17 VTLNRPKALNALSDLLVTELGQALDALEADDSVGAIVVTGSEKA-FAAGADIKEMQNFSY 75 Query: 118 SEVHTYVNSLRYMFSFIEALSIPTIAAIEGAALGGGLEMALACDLRICGENAVFGLPETG 177 +V+ N + + + PTIAA+ G ALGGG E+A+ D + + A FG PE Sbjct: 76 MDVYK-ANFITAKWERLAKCRKPTIAAVAGYALGGGCELAMMADFILAADTAKFGQPEIT 134 Query: 178 LAIIPGAGGTQRLSRLVGRSVSKELIFTGRKIDAIEAANKGLVNICVTAGEAHEKAIEMA 237 + IPGAGGTQRL+R VG+S + E+ TGR +DA EA GLV+ V A + ++A+ +A Sbjct: 135 IGTIPGAGGTQRLTRFVGKSKAMEMCLTGRLMDAAEAERAGLVSRVVPAVDLVDEAVRVA 194 Query: 238 QQINEKGPLAIKMAKKAIDEGIETNMASGLEVEEMCYQKLLNTQDRLEGLAAFAEKRKP 296 ++I + + MAK A++ ET M+ G+ VE + +D+ EG+AAFAEKR+P Sbjct: 195 EKIAKLSRPVVMMAKDAVNAAYETTMSEGIRVERRIFHATFAVEDQKEGMAAFAEKRQP 253 Lambda K H 0.318 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 258 Length adjustment: 25 Effective length of query: 276 Effective length of database: 233 Effective search space: 64308 Effective search space used: 64308 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory