Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate AZOBR_RS26485 AZOBR_RS26485 enoyl-CoA hydratase
Query= BRENDA::Q1D5Y4 (258 letters) >FitnessBrowser__azobra:AZOBR_RS26485 Length = 262 Score = 170 bits (431), Expect = 2e-47 Identities = 98/252 (38%), Positives = 141/252 (55%), Gaps = 5/252 (1%) Query: 10 GPIEIWTIDGESRRNAISRAMLKELGELVTRVSSSRDVRAVVITGAGDKAFCAG---ADL 66 G + + TI+ + NA+ L EL + + S V +V+TGAG++AF AG ADL Sbjct: 13 GAVGLITINRPTTLNALDVPTLLELERALGELESDDGVHVIVVTGAGERAFVAGGDIADL 72 Query: 67 KERATMAEDEVRAFLDGLRRTFRAIEKSDCVFIAAINGAALGGGTELALACDLRVAAPAA 126 R +A F + + R FR E D IAA+NG ALGGGTEL L+ D+R+AA A Sbjct: 73 DSRQGLAH--YLDFAEVVHRVFRRFETCDKPTIAAVNGWALGGGTELVLSLDIRIAADTA 130 Query: 127 ELGLTEVKLGIIPGGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRLAPEGHL 186 + GL E+ LG+ PG GGTQR+ R + P RA++L+ T + AAEA + GL NR P+ L Sbjct: 131 KFGLPEINLGLFPGAGGTQRILRQIPPCRARELVFTGDQFTAAEAVAWGLVNRAVPKADL 190 Query: 187 LAVAYGLAESVVENAPIAVATAKHAIDEGTGLELDDALALELRKYEEILKTEDRLEGLRA 246 +A A A+ + +P+ + K + G + L +LA E +L ++D EG RA Sbjct: 191 MAEAMATAQKIAAKSPLILKLTKRTLRHGAEMPLGASLAYEQAMIGLVLDSQDAHEGCRA 250 Query: 247 FAEKRAPVYKGR 258 F EKR + G+ Sbjct: 251 FLEKRKAAFTGQ 262 Lambda K H 0.319 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 262 Length adjustment: 24 Effective length of query: 234 Effective length of database: 238 Effective search space: 55692 Effective search space used: 55692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory