Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate AZOBR_RS03565 AZOBR_RS03565 branched-chain amino acid ABC transporter permease
Query= uniprot:Q1MCU0 (300 letters) >FitnessBrowser__azobra:AZOBR_RS03565 Length = 304 Score = 234 bits (598), Expect = 1e-66 Identities = 122/297 (41%), Positives = 186/297 (62%), Gaps = 8/297 (2%) Query: 3 YFVQQLLNGLTLGSIYGLVAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLVLTSIFA 62 +F+QQL+N T+ +YGL+A+GYT+VYGI+G IN A G++ M+G + L Sbjct: 3 FFLQQLINAATVACVYGLLALGYTLVYGILGQINLAMGELTMIGAMLTAMGAAALGMAGL 62 Query: 63 G-LPVAVLLLVMLVVAMLMTSLWNWTIERVAYRPLRGSFRLAPLITAIGMSITLSNFIQV 121 G LP+AVL + V+A T++ WT++R+ +R LR + PLI A+G+SI +++ Sbjct: 63 GSLPLAVLGVFATVMAF--TAVQGWTMDRLVFRRLRRTHNHTPLIAAVGLSIAYQEGMRL 120 Query: 122 TQGPRNKPIPPMVSSVYQFGN-----ISVSLKQIIIIVITAVLLTIFWYIVNRTALGRAQ 176 G R+ ++ ++ + ++ Q +I+++T L + W I+ RTA GRA Sbjct: 121 LHGARDWWPAQFLADRHELLSDGAFTVTALTSQAVILLMTGGLYALLWAIMQRTAYGRAH 180 Query: 177 RATEQDRKMAALLGVNVDQTISITFVMGAALAAVAGTMYLMYYGVASFNDGFTPGVKAFT 236 RA D A L+GV+VD+T++ TF +G ALAA AG + +YYG +F G+ G KA Sbjct: 181 RACADDVGAAELVGVDVDRTVATTFAVGGALAAAAGAVIALYYGGVNFYTGYLVGFKALA 240 Query: 237 AAVLGGIGSLPGAVFGGLLIGLIESLWSAYFTIAYKDVATFAILAFVLIFKPTGILG 293 AAV+GGIGS+PGA+ GG L+GL+E+ WSAYF IAYKD+ F +L LI++P G++G Sbjct: 241 AAVVGGIGSVPGAMLGGALLGLVETFWSAYFAIAYKDIVAFGLLTLFLIYRPDGLMG 297 Lambda K H 0.329 0.143 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 304 Length adjustment: 27 Effective length of query: 273 Effective length of database: 277 Effective search space: 75621 Effective search space used: 75621 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory