Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate AZOBR_RS28570 AZOBR_RS28570 amino acid ABC transporter ATPase
Query= TCDB::P73650 (240 letters) >FitnessBrowser__azobra:AZOBR_RS28570 Length = 241 Score = 194 bits (493), Expect = 1e-54 Identities = 110/241 (45%), Positives = 149/241 (61%), Gaps = 7/241 (2%) Query: 4 LLVVKDVFAGYVADVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEII 63 +L V D+ Y + L+G++ + GE+V +IG NGAGKS+L + I GL+ P+ G + Sbjct: 1 MLTVADLSVSY-GPIRALRGVSIRVGAGEIVALIGANGAGKSSLLRGITGLV-PATGRVT 58 Query: 64 FKGENITGLGSDQIVRRGMCYVPQVCNVFGSLTVAENLDMGAFLHQGPTQTLK---DRIY 120 F G I GL + Q V G+ P+ +F TV ENL +G L +G Q + DR Y Sbjct: 59 FDGRPIDGLSTPQRVALGVAMAPEGRQIFTDQTVHENLLLGGHLLRGRPQRIAANIDRFY 118 Query: 121 TMFPKLAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFAQIK 180 +FP+L +RR+Q AGTLSGGE+QMLA+ RALM +P LL+LDEPS L+PI+ D+F + Sbjct: 119 ALFPRLLERRDQIAGTLSGGEQQMLAIARALMTEPKLLILDEPSLGLAPIITADIFRTLV 178 Query: 181 AINATGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLVGELYLGA--AY 238 + G I+LVEQ A QAL +ADR YVLE G LEG +L DP + E YLG A+ Sbjct: 179 GLRRDGMTILLVEQMANQALAIADRAYVLEGGSIVLEGVAATLRRDPRIREAYLGGDLAH 238 Query: 239 H 239 H Sbjct: 239 H 239 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 241 Length adjustment: 23 Effective length of query: 217 Effective length of database: 218 Effective search space: 47306 Effective search space used: 47306 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory