Align Putative aldehyde dehydrogenase transmembrane protein; EC 1.2.1.3 (characterized, see rationale)
to candidate AZOBR_RS09720 AZOBR_RS09720 succinate-semialdehyde dehdyrogenase
Query= uniprot:Q92L07 (510 letters) >FitnessBrowser__azobra:AZOBR_RS09720 Length = 497 Score = 218 bits (555), Expect = 4e-61 Identities = 149/464 (32%), Positives = 232/464 (50%), Gaps = 13/464 (2%) Query: 26 DLYTGGDMPSFSPVTGEKIASLKTVSAAEAAGKIEKADEAFRAWRLVPAPKRGELVRLLG 85 D +G + +P G + S+ + A E IE A+ A+ AWR + A +R + +R Sbjct: 32 DADSGKTVEVTNPADGSVLGSVPMMGADETRRAIEAAERAWPAWRALTAKERAKTLRTWF 91 Query: 86 EELRAFKADLGRLVSIEAGKIPSEGLGEVQEMIDICDFAVGLSRQLYGLTIATERPGHRM 145 + + A + D+ R+++ E GK +E GEV ++ +++YG TI PG R+ Sbjct: 92 DLMMANQEDIARIMTAEQGKPLAEARGEVAYAASFIEWFAEEGKRVYGDTIPQHLPGRRI 151 Query: 146 METWHPLGVVGIISAFNFPVAVWSWNAALALVCGDAVVWKPSEKTPLTALACQAILERAI 205 + T P+GV I+ +NFP A+ + A AL G +V KP+ TPLTALA + ERA Sbjct: 152 VVTKEPIGVTAAITPWNFPAAMITRKAGPALAAGCPMVIKPATATPLTALAMAVLAERA- 210 Query: 206 ARFGDAPEGLSQVLIGD-RAIGEVLVDHPKVPLVSATGSTRMGREVGPRLAKRFARAILE 264 P G+ V+ G RAIG + +P V ++ TGST +G+E+ + A + LE Sbjct: 211 ----GIPAGILSVVTGSARAIGGEMTGNPTVRKLTFTGSTEIGKELMAQCAGTVKKVSLE 266 Query: 265 LGGNNAGIVCPSADLDMALRAIAFGAMGTAGQRCTTLRRLFVHESVYDQLVPRLKKAYQS 324 LGGN +V ADLD A++ GQ C RL V VYD +L +A ++ Sbjct: 267 LGGNAPFLVFNDADLDEAVKGAIASKYRNTGQTCVCANRLLVQSGVYDAFAAKLAEAVKA 326 Query: 325 VSVGNPLES-AALVGPLVDKAAFDGMQKAIAEAKNHGG-AVTGGERVELGHENGYYVKPA 382 + VG L + A GPL+D AA + ++ I +A G V GG+R ELG ++ Sbjct: 327 LKVGPGLTTEGAQQGPLIDMAAVEKVEDHIRDATEKGARVVLGGKRHELG--GSFFEPTI 384 Query: 383 LVEMPKQEGPVLEETFAPILYVMKYSDFDAVLAEHNAVAAGLSSSIFTRDMQESERFLAA 442 L ++ EETF P+ + ++ + + NA GL++ ++RD+ R A Sbjct: 385 LADVTPAMKVAREETFGPVAPLFRFETEEEAVRMANATEFGLAAYFYSRDIGRVWR--VA 442 Query: 443 DGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSDAWKAYM 486 + + GI +N G E+ FGG KE+G GRE + Y+ Sbjct: 443 EALEYGIVGINEGIISTEV-APFGGMKESGIGREGSKYGIEDYL 485 Lambda K H 0.317 0.134 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 574 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 510 Length of database: 497 Length adjustment: 34 Effective length of query: 476 Effective length of database: 463 Effective search space: 220388 Effective search space used: 220388 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory