Align Glutarate-semialdehyde dehydrogenase; EC 1.2.1.- (characterized)
to candidate AZOBR_RS26825 AZOBR_RS26825 aldehyde dehydrogenase
Query= SwissProt::Q9I6M5 (483 letters) >FitnessBrowser__azobra:AZOBR_RS26825 Length = 494 Score = 273 bits (698), Expect = 1e-77 Identities = 154/470 (32%), Positives = 258/470 (54%), Gaps = 11/470 (2%) Query: 15 VDGAWVDADNGQTIKVNNPATGEIIGSVPKMGAAETRRAIEAADKALPAWRALTAKERAN 74 + G A G+T V NPATG++I + G + A+ AA A AW L+A+ER Sbjct: 20 IGGELRPAATGKTFDVVNPATGDVIATAADGGERDVDAAVRAAVAAQGAWARLSARERGR 79 Query: 75 KLRRWFDLMIENQDDLARLMTIEQGKPL-AEAKGEIAYAASFLEWFGEEAKRIYGDTIPG 133 L ++ + +++ RL+ +E GK + E++ E + A L ++G A + G+T+P Sbjct: 80 LLVECGRRLVGHAEEIGRLLALETGKAIRTESRVEASLVADTLTFYGGLASELKGETVPF 139 Query: 134 HQPDKRIIVIKQPIGVTAAITPWNFPSAMITRKAGPALAAGCTMVLKPASQTPYSALALA 193 H P ++PIGV AI PWN P ++ K PAL AG +++K A + P +AL + Sbjct: 140 H-PKMLTFTQREPIGVVGAIIPWNVPLYLMALKIAPALVAGNAVIVKSAEEAPLAALRVI 198 Query: 194 ELAERAGIPKGVFSVVTGSAGEVGGELTSNPIVRKLTFTGSTEIGRQLMAECAQDIKKVS 253 ++ + +P GV ++++G G L ++P V K+TFTGS E G+ + A + V+ Sbjct: 199 QVMNQL-LPPGVLNILSGDGPGCGAPLVTHPGVGKVTFTGSVETGKIISHLAADKLIPVT 257 Query: 254 LELGGNAPFIVFDDADLDAAVEGALIS-KYRNNGQTCVCANRLYVQDGVYDAFVDKLKAA 312 LELGG +P IV DADLD A++GA+ ++ GQ+C ++R++V + ++DAF+DKLKA Sbjct: 258 LELGGKSPMIVMGDADLDKAIDGAVAGMRFTRQGQSCTASSRIFVHESLHDAFIDKLKAK 317 Query: 313 VAKLNIGNGLEAGVTTGPLIDAKAVAKVEEHIA------DAVSKGAKVVSGGKPHALGGT 366 V + +G+ L+ G +I + +V+ +IA A++ + + A G Sbjct: 318 VDAMTMGDPLDEATDIGTIISPQQFERVQSYIALGETTAGAIAHRCSALPTDERLARG-L 376 Query: 367 FFEPTILVDVPKNALVSKDETFGPLAPVFRFKDEAEVIAMSNDTEFGLASYFYARDLARV 426 F +P + + + ++++E FGP+ V F+D + +AM+ND++FGLA+ + RDL Sbjct: 377 FVQPVLFTGLANDHRLAREEIFGPVTCVIAFRDYEDALAMANDSDFGLAATIWTRDLRTA 436 Query: 427 FRVAEQLEYGMVGINTGLISNEVAPFGGIKASGLGREGSKYGIEDYLEIK 476 +L+ G V +N L+ +GG K SGLG+E S + D+ K Sbjct: 437 LDATRRLQAGFVQVNQNLVVQPGLSYGGFKQSGLGKEASLEAMLDHFTHK 486 Lambda K H 0.317 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 531 Number of extensions: 30 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 483 Length of database: 494 Length adjustment: 34 Effective length of query: 449 Effective length of database: 460 Effective search space: 206540 Effective search space used: 206540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory