Align Delta(1)-pyrroline-2-carboxylate/Delta(1)-piperideine-2-carboxylate reductase; Pyr2C/Pip2C reductase; N-methyl-L-amino acid dehydrogenase; NMAADH; EC 1.5.1.21; EC 1.4.1.17 (characterized)
to candidate AZOBR_RS16020 AZOBR_RS16020 malate dehydrogenase
Query= SwissProt::Q5FB93 (341 letters) >FitnessBrowser__azobra:AZOBR_RS16020 Length = 356 Score = 154 bits (389), Expect = 3e-42 Identities = 90/243 (37%), Positives = 129/243 (53%), Gaps = 5/243 (2%) Query: 17 LQSLLQAIFQRHGCSEAVARVLAHNCASAQRDGAHSHGVFRMPGYVSTLASGWVDGQATP 76 L +LL AI QR G S A ++A N + G SHGV ++ Y +L G + Sbjct: 10 LVALLDAILQRSGSSPEEAAIVAANLVDSDATGHASHGVCQIAVYAKSLELGHLQPNRHA 69 Query: 77 QVSDVAAGYVRVDAAGGFAQPALAAARELLVAKARSAGIAVLAIHNSHHFAALWPDVEPF 136 +V A ++ VD G+ Q A +L +A+A++ G VLA+ N+HH + E Sbjct: 70 RVVRDEAPFLVVDGEVGYGQVIAREATDLAIARAKAGGACVLALRNAHHIGRVGAYGEQC 129 Query: 137 AEEGLVALSVVN--SMTCVVPHGARKPLFGTNPIAFAAPCAE-HDPIVFDMATSAMAHGD 193 GL+ + VN S PHG +P GTNPI A P H P + D ATSA+A Sbjct: 130 IAAGLIGVFFVNVVSRPLAAPHGGGRPRLGTNPICIAVPATPGHPPFLLDFATSAVAANK 189 Query: 194 VQIAARAGQQLPEGMGVDADGQPTTDPKAILEG--GALLPFGGHKGSALSMMVELLAAAL 251 ++AA +G+++ +G+ +D G PT DP + GA+LPFGGHKG L++ E+LA AL Sbjct: 190 CRVAAASGKEVADGLLIDERGAPTRDPGVMFRDPTGAILPFGGHKGYGLALACEILAGAL 249 Query: 252 TGG 254 GG Sbjct: 250 AGG 252 Lambda K H 0.318 0.132 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 356 Length adjustment: 29 Effective length of query: 312 Effective length of database: 327 Effective search space: 102024 Effective search space used: 102024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory