Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 2/3) (EC 1.3.1.109) (characterized)
to candidate AZOBR_RS05480 AZOBR_RS05480 protein fixA
Query= BRENDA::Q18AQ6 (260 letters) >FitnessBrowser__azobra:AZOBR_RS05480 Length = 283 Score = 204 bits (519), Expect = 2e-57 Identities = 108/235 (45%), Positives = 154/235 (65%), Gaps = 8/235 (3%) Query: 1 MNIVVCIKQVPDTTEVKLDPNTGTLIRDGVPSIINPDDKAGLEEAIKLKEEMGAHVTVIT 60 M+IVVCIKQVPD+ ++++ P T T++R GVP+IINP D LEEA+++K+++GA VTV+T Sbjct: 1 MHIVVCIKQVPDSAQIRIHPVTNTIMRQGVPAIINPFDLFSLEEALRIKDKVGARVTVLT 60 Query: 61 MGPPQADMALKEALAMGADRGILLTDRAFAGADTWATSSALAGALKNI----DFDIIIAG 116 MGPP A+ +L++AL++GAD +LLTDR FAG+DT ATS AL A+K + D++ G Sbjct: 61 MGPPMAETSLRKALSLGADDAVLLTDRKFAGSDTLATSYALTSAIKKLSEEEQVDLVFCG 120 Query: 117 RQAIDGDTAQVGPQIAEHLNLPSITY---AEEIKTEGEYVLVKRQFEDCCHDLKVKMPCL 173 +Q +DGDTAQVGP IA L +TY E I ++V R+ E LK +PC+ Sbjct: 121 KQTVDGDTAQVGPGIATRLGFQQLTYITKIESIDQGAREIVVHRRSEGGVQVLKTALPCM 180 Query: 174 ITTLKDMNTPRYMKVGRIYDAFENDVVETWTVKDIEVDPSNLGLKGSPTSVFKSF 228 IT L+ NT R+ K+ ++ A ++TW + + +GLKGSPT V K F Sbjct: 181 ITMLEGTNTIRFGKMDDMFRAARYG-LKTWNKDTTGAEETKVGLKGSPTVVSKVF 234 Lambda K H 0.316 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 283 Length adjustment: 25 Effective length of query: 235 Effective length of database: 258 Effective search space: 60630 Effective search space used: 60630 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory