GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fadB in Azospirillum brasilense Sp245

Align Probable 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 (characterized)
to candidate AZOBR_RS20225 AZOBR_RS20225 3-hydroxyacyl-CoA dehydrogenase

Query= SwissProt::O32178
         (789 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS20225 AZOBR_RS20225
           3-hydroxyacyl-CoA dehydrogenase
          Length = 777

 Score =  507 bits (1306), Expect = e-148
 Identities = 310/798 (38%), Positives = 442/798 (55%), Gaps = 36/798 (4%)

Query: 5   IRKAAVLGSGVMGSGIAAHLANIGIPVLLLDIVPNDLTKEEEKKGLTKDSSEVRSRLSRQ 64
           I++AAV+GSGVMGSGIAAH AN GIPV+LLDI   +               + RS +++ 
Sbjct: 3   IKRAAVIGSGVMGSGIAAHFANAGIPVVLLDIPAKE--------------GDDRSAIAKG 48

Query: 65  AMKKLLKQKPAPLTSAKNTSYITPGNLEDDAEKLKEADWIIEVVVENLEVKKKIFALVDE 124
           A+++LLK  PAP    KN   +TPGNLEDD   L + DWI+E +VEN  VK  ++  +D 
Sbjct: 49  AVQRLLKTDPAPFMHPKNAKLVTPGNLEDDLALLADVDWIVEAIVENPAVKADLYRRIDP 108

Query: 125 HRKTGSIVSSNTSGISVQEMAEGRSDDFKAHFLGTHFFNPARYLKLLEIIPIKETDPDIL 184
            RK GS+VSSNTS I +  + EG+SD F+  FL THFFNP RY++LLEI+  + T PD L
Sbjct: 109 VRKAGSVVSSNTSTIPLGVLVEGQSDAFRRDFLITHFFNPPRYMRLLEIVGGEATRPDAL 168

Query: 185 KFMTAFGENVLGKGVVTAKDTPNFIANRIGTYGLLVTVQEMLKGGYQVGEVDSITGPLIG 244
             +    +  LGKGVV  KDTP FIANRIG Y +   +   +  G  V E D+I G  +G
Sbjct: 169 AAVADVCDRALGKGVVRCKDTPGFIANRIGVYWIQTAINAAVDLGLTVEEADAIVGRPMG 228

Query: 245 RPKSATFRTLDVVGLDTFAHVARNVYDKADGDE--KEVFRIPSFMNDMLEKGWIGSKAGQ 302
            PK+  F  +D+VGLD   H+A+++      ++  +  FR    +  M+ +G+ G K   
Sbjct: 229 IPKTGVFGLVDLVGLDLMPHIAKSLLATLPENDPYRAAFREHPVITRMIAEGYTGRKGKG 288

Query: 303 GFYKKE---GKTIYELDPVTLTYGERTKMKSPALEAAKQAKGTKAKMKALIYSDDRAGRL 359
           GFY+     G  + E+  + L+ G   +   P LE+          ++AL    D+ G+ 
Sbjct: 289 GFYRLNRDGGAKVKEV--IDLSTGAYRRSDKPKLESVST---VGRDLRALADFPDKTGQY 343

Query: 360 LWNITSQTLLYSAELLGEIADDIHAIDQAMKWGFGWELGPFEMWDAIGLKQSAEKLEQLG 419
              + + TL Y+A L+ EIAD I A+D+ M+ G+ W+ GPFE+ D +G    A+     G
Sbjct: 344 ARRVLAHTLAYAASLVPEIADSIVAVDEGMRLGYNWKQGPFELIDRLGTAWFADLCRSEG 403

Query: 420 ADMPGWIKEMLDKGNETFYIKENGTVFYY-DRGEYRAVKENKKRIHLQALKETKGVIAKN 478
             +P  +++        FY  E+G + +    G Y  V      + L  +K     + KN
Sbjct: 404 IPVPALVEQ---AAGRPFYRVEDGRLQHLTTAGLYDTVVRPDGVLLLSDIKRASQPVWKN 460

Query: 479 SGASLIDLGDDVALLEFHSKSNAIGLDIIQMIHKGLE---ETERNYKGLVIGNQGKNFCV 535
             ASL D+GD V  +EF SK NA+  D++    K ++   + + N+K LVI N+  NF V
Sbjct: 461 GSASLWDIGDGVLCVEFTSKMNALDGDVMAAYGKAMKLIGDGKGNWKALVIHNESDNFSV 520

Query: 536 GANLAMILMEVQDDNFLEVDFVIRRFQETMMKIKYSAKPVVAAPFGMTLGGGTEACLPAA 595
           GANL + L  +    + +++ ++   Q     +KY+  PVV+AP GM LGGG E  L + 
Sbjct: 521 GANLGLALFALNVGLWPQIEELVEGGQRAYRALKYAPFPVVSAPSGMALGGGCEILLHSD 580

Query: 596 RIQAASEAYMGLVESGVGLIPGGGGNKELYINHL---RRGHDPMNAAMKTFETIAMAKVS 652
            +QA +E YMGLVE GVGLIPG GG  E+   H    R    PM      FETI++AKV+
Sbjct: 581 HVQAHAETYMGLVEVGVGLIPGWGGCTEMLARHAANPRTPKGPMPPIAGAFETISLAKVA 640

Query: 653 ASAQEAREMNILKETDQISVNQDHLLYDAKQLAASLYDTGWRPPVKEKVKVPGETGYAAL 712
            SA EA+++  L+ +D I++N+D LL DAK  A  L    + PP K    +PG  G AAL
Sbjct: 641 KSAAEAKDLLYLRASDGITMNRDRLLADAKAKALEL-AANYTPPEKVTYTLPGPNGRAAL 699

Query: 713 LLGAEQMKLSGYISEHDFKIAKKLAYVIAGG-KVPFGTEVDEEYLLEIEREAFLSLSGEA 771
            L  E   L G  + HD  +  KLA ++ GG K      V E+ +L +ER AF+ L    
Sbjct: 700 ELFLEGFALQGKATPHDMVVCGKLAGILTGGPKADVTQPVTEDQMLALERRAFMELVRTE 759

Query: 772 KSQARMQHMLVKGKPLRN 789
            +  R++HML  GKPLRN
Sbjct: 760 GTIDRVEHMLTTGKPLRN 777


Lambda     K      H
   0.316    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1348
Number of extensions: 70
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 789
Length of database: 777
Length adjustment: 41
Effective length of query: 748
Effective length of database: 736
Effective search space:   550528
Effective search space used:   550528
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory