Align Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)
to candidate AZOBR_RS15690 AZOBR_RS15690 glutamine ABC transporter ATP-binding protein
Query= uniprot:Q88GX0 (260 letters) >FitnessBrowser__azobra:AZOBR_RS15690 Length = 239 Score = 313 bits (801), Expect = 3e-90 Identities = 149/235 (63%), Positives = 190/235 (80%) Query: 25 GLNKHYGAFHVLRDIDLQVREGERIVLCGPSGSGKSTLIRCINRLEVAQQGSIQVDGIDL 84 G+ K Y +FHVL+DI+L+V +GERIV+CGPSGSGKSTLIRCIN+LE Q+G+I V+G+ + Sbjct: 3 GVQKWYDSFHVLKDIELEVHKGERIVICGPSGSGKSTLIRCINQLEKHQKGTITVNGVTI 62 Query: 85 AATTREAAQVRSDIGMVFQHFNLFPHMSVLDNCLLAPTSVRGLSRKDAEERARMYLSKVG 144 A R QVR D+GMVFQ FNLFPH++V++NC+LAP VRG S+++A + A YL++V Sbjct: 63 DAHHRHLDQVRRDVGMVFQQFNLFPHLTVVENCMLAPMRVRGTSKQEARDIAMKYLARVR 122 Query: 145 IESQAHKYPSQLSGGQQQRVAIARALCMKPRIMLFDEPTSALDPEMVAEVLDVLVQLAGT 204 I QA KYP QLSGGQQQRVAIAR+LCM P++MLFDEPTSALDPEMV EVLD ++ LA Sbjct: 123 IPEQADKYPGQLSGGQQQRVAIARSLCMNPKVMLFDEPTSALDPEMVKEVLDTMIGLAED 182 Query: 205 GMTMLCVTHEMGFARQVAERVLFLEGGQIIEDSPPQVFFNQPRTERAKAFLAQIL 259 GMTMLCVTHEMGFA+ VA+RV+F++ G+I+E + P FF P++ER + FL QIL Sbjct: 183 GMTMLCVTHEMGFAKSVADRVIFMDRGEIVEQATPAEFFTNPKSERTRNFLGQIL 237 Lambda K H 0.322 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 239 Length adjustment: 24 Effective length of query: 236 Effective length of database: 215 Effective search space: 50740 Effective search space used: 50740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory