Align ABC transporter for L-Lysine, ATPase component (characterized)
to candidate AZOBR_RS23525 AZOBR_RS23525 ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_09895 (257 letters) >FitnessBrowser__azobra:AZOBR_RS23525 Length = 269 Score = 257 bits (656), Expect = 2e-73 Identities = 134/251 (53%), Positives = 175/251 (69%), Gaps = 16/251 (6%) Query: 8 LEIRNLHKRYGQLEVLKGVSLTARDGDVISILGSSGSGKSTFLRCINLLENPNQGQILVA 67 +EIRN++K +G EVLK VSLT ++G SGSGKST LRC N LE ++G+I + Sbjct: 2 IEIRNVYKSFGSTEVLKDVSLTVPPSRTTVVIGPSGSGKSTLLRCCNCLETADRGEIRI- 60 Query: 68 GEELKLKAAKNGELVAADGK-----QINRLRSEIGFVFQNFNLWPHMSVLDNIIEAPRRV 122 N + ADGK ++N LR+E G VFQ+FNL+PHM+ ++N++ AP V Sbjct: 61 ----------NHRTIIADGKPLPDKELNALRAETGMVFQSFNLFPHMTTVENVMRAPVVV 110 Query: 123 LGQSKAEAVEVAEALLAKVGIADKRHAYPAELSGGQQQRAAIARTLAMQPKVILFDEPTS 182 G +KAEA E+A LL KVG+ DK YP+ LSGGQ+QRAAIAR LAM+PKV+LFDEPTS Sbjct: 111 RGMAKAEARELAMELLRKVGLGDKADVYPSTLSGGQKQRAAIARALAMKPKVMLFDEPTS 170 Query: 183 ALDPEMVQEVLSVIRALAEEGRTMLLVTHEMGFARQVSSEVVFLHQGLVEEQGSPQQVFE 242 ALDPE+V EVL V++ LAEEG TM++VTHEMGFAR+V+ VV + G + E GSP+Q+F Sbjct: 171 ALDPELVGEVLQVMKTLAEEGMTMMVVTHEMGFAREVADTVVVMADGRIVESGSPEQIFT 230 Query: 243 NPLSARCKQFM 253 NP R + F+ Sbjct: 231 NPTQERTRGFL 241 Lambda K H 0.317 0.132 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 269 Length adjustment: 25 Effective length of query: 232 Effective length of database: 244 Effective search space: 56608 Effective search space used: 56608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory