Align 3-keto-5-aminohexanoate cleavage enzyme (EC 2.3.1.247) (characterized)
to candidate AZOBR_RS27000 AZOBR_RS27000 3-keto-5-aminohexanoate cleavage protein
Query= BRENDA::Q8RHX2 (272 letters) >FitnessBrowser__azobra:AZOBR_RS27000 Length = 316 Score = 156 bits (394), Expect = 6e-43 Identities = 103/301 (34%), Positives = 159/301 (52%), Gaps = 33/301 (10%) Query: 3 EKLIITAAICGAEVTKEHNPAVPYTVEEIAREAESAYKAGASIIHLHVRED-DGTPTQDK 61 +K+II+ A+ G+ T + A+P T +EI + A +AGA+I+HLH R+ G PT D Sbjct: 10 KKVIISCALTGSIHTPTMSDALPVTPDEIVEQGVGAAEAGAAILHLHARDPRTGQPTPDP 69 Query: 62 ERFRKCIEAIREKCPDVIIQPSTGGAVGMTDLERLQ-PTELHPEMATLDCGTCNFG---- 116 F + + +++ D ++ +TGG++ MT ERL P + PEM +L+ G+ NFG Sbjct: 70 AVFMQFLPRLKQST-DAVLNITTGGSLNMTVQERLAAPLQARPEMCSLNMGSMNFGIFPL 128 Query: 117 -------------------GDEIFVNTENTIKNFGKILIER-GVKPEIEVFDKGMIDYAI 156 D IF NT I + L E G + E E +D G + Sbjct: 129 ADRYQGWKHDWEEPYLRSTDDFIFRNTFRDIAYILEHLGEGCGTRFEFECYDVGHLYNLA 188 Query: 157 RYQKQGFIQKPMHFDFVLGVQ--MSASARDLVFMSESIPE----GSTWTVAGVGRHQFQM 210 + +G ++ P + G+ + A R+LVFM E+ W+V GRHQ Sbjct: 189 HFVDRGLVKPPFFVQTIFGILGGIGAEQRNLVFMRETADRLFGTDYEWSVLAAGRHQIPF 248 Query: 211 AALAIVMGGHVRVGFEDNVYIDKGILAKSNGELVERVVRLAKELGREIATPDEARQILSL 270 +A VMGG+VRVG ED++Y+ KG LA+++ E V ++ R+ +EL E+ATP EAR +L+L Sbjct: 249 TTMAAVMGGNVRVGLEDSLYLSKGRLARNSAEQVAKIRRILEELSLEVATPAEARAMLAL 308 Query: 271 K 271 K Sbjct: 309 K 309 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 316 Length adjustment: 26 Effective length of query: 246 Effective length of database: 290 Effective search space: 71340 Effective search space used: 71340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory