Align ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) (characterized)
to candidate AZOBR_RS25590 AZOBR_RS25590 sugar ABC transporter permease
Query= BRENDA::P68183 (296 letters) >FitnessBrowser__azobra:AZOBR_RS25590 Length = 277 Score = 110 bits (276), Expect = 3e-29 Identities = 91/283 (32%), Positives = 131/283 (46%), Gaps = 23/283 (8%) Query: 18 LLLLLFIAAIMFPLLMVVAISLRQGN-FATGSLIPEQISWDHWKLALGFSVEQADGRITP 76 LL+L +A +FP + SL+ G+ T P Q S ++ EQ GR Sbjct: 14 LLVLGIVAWAVFPFAWAIVTSLKAGSALFTVEAWPSQPSLANYAAIFK---EQPFGRN-- 68 Query: 77 PPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLS 136 + NS+ A + L+ AYA R+RF G+ LL +L MFP V Sbjct: 69 --------ILNSLLAASAVVALSLGLAVLAAYALGRVRFRGRGLLLFVVLGVSMFPQVAV 120 Query: 137 LVALYALFDRLGEYIPFIGLNTHGGVIFAYL-GGIALHVWTIKGYFETIDSSLEEAAALD 195 L L+ L LG Y N G ++ +YL + VW + + + LEEAA +D Sbjct: 121 LSGLFELVRWLGLY------NRIGSLVLSYLIFTLPFTVWVLTTFMRELPKELEEAAMVD 174 Query: 196 GATPWQAFRLVLLPLSVPILAVVFILSFIAAITE--VPVASLLLRDVNSYTLAVGMQQYL 253 GA P+ V LPL P LA +L+FIAA E + L D + +A+ + Sbjct: 175 GAGPFVIVTRVFLPLMGPALAATGLLAFIAAWNEFLFALTFTLTDDARTVPVAIALMSGA 234 Query: 254 NPQNYLWGDFAAAAVMSALPITIVFLLAQRWLVNGLTAGGVKG 296 + WG AA+V+ +P+ + LL QR +V+GLTAG VKG Sbjct: 235 SQYELPWGQIMAASVVVTVPLIGLVLLFQRRIVSGLTAGAVKG 277 Lambda K H 0.328 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 277 Length adjustment: 26 Effective length of query: 270 Effective length of database: 251 Effective search space: 67770 Effective search space used: 67770 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory