Align ABC-type Maltose/ Maltodextrin permease (characterized, see rationale)
to candidate AZOBR_RS18180 AZOBR_RS18180 sugar ABC transporter
Query= uniprot:Q6MNM1 (272 letters) >FitnessBrowser__azobra:AZOBR_RS18180 Length = 273 Score = 176 bits (446), Expect = 5e-49 Identities = 88/264 (33%), Positives = 147/264 (55%) Query: 9 ISILLFSLFSIYPILYVLSVSLRPDNAFQTQSLEIIGPNASFKNFVDLFATTDFLIWMRN 68 +++L+ + +P+ ++L SL P ++ + + F T W+ N Sbjct: 10 LAVLVLLGVAAFPLYWMLVTSLTPSERLFDDRPNLLPTLSQIGTYAAAFTETSLRQWLIN 69 Query: 69 SLVVSAATTLLGVALASTSAYALARYRFRGRNMMLFSLLMTQMFPATMLMLPFYIILSKL 128 SL+V+ TT+L + L+ AYAL+R F G+ ++ F+L MTQM P ML++P Y I +KL Sbjct: 70 SLIVAVGTTVLSILLSVLPAYALSRLTFNGKLLLGFALFMTQMLPEAMLVVPLYDIFTKL 129 Query: 129 RLIDSFWGLFLIYSSTALPFCIWQMKAYYDTIPRELEEAALLDGCSKWMIFYKIILPVSS 188 L+++ GL L ++ +P W +K D +P E+EEAA +DGCS+ I +++P+ + Sbjct: 130 SLLNTLLGLILANTAFTVPVVTWILKGAIDGVPSEIEEAARVDGCSRLGIVLAVVVPLIA 189 Query: 189 PALVITALFSFMSSWSEYVIAAVVLQDPQLYTLPLGLRSFQASLATQWGLYAAGALIVSV 248 P L A+ +F W+EYV A + D L T +GL SF L+T A I ++ Sbjct: 190 PTLAAAAVIAFFHGWNEYVFAQTFISDDALRTASVGLASFVGELSTPVHTVMAVGFIYTL 249 Query: 249 PVLILFISISRYLVSGLTMGSVKG 272 P ++ ++ + RY+V+G+T G VKG Sbjct: 250 PAVVFYLFVQRYVVAGMTTGGVKG 273 Lambda K H 0.329 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 273 Length adjustment: 25 Effective length of query: 247 Effective length of database: 248 Effective search space: 61256 Effective search space used: 61256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory