GapMind for catabolism of small carbon sources

 

Aligments for a candidate for susB in Azospirillum brasilense Sp245

Align α-glucosidase (Gsj) (EC 3.2.1.20) (characterized)
to candidate AZOBR_RS04510 AZOBR_RS04510 trehalose synthase

Query= CAZy::BAE48285.1
         (555 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS04510 AZOBR_RS04510 trehalose
           synthase
          Length = 562

 Score =  249 bits (635), Expect = 3e-70
 Identities = 177/551 (32%), Positives = 261/551 (47%), Gaps = 98/551 (17%)

Query: 1   MKKTWWKEGVAYQIYPRSFMDANGDGIGDLRGIIEKLDYLVELGVDIVWICPIYRSPNAD 60
           +K  W+K  V Y +   +FMDANGDGIGD +G+  +LDYL  LGV  +W+ P   SP  D
Sbjct: 2   IKDLWYKNAVIYNLSVGTFMDANGDGIGDFQGLQRRLDYLQGLGVTCLWLGPFQPSPMRD 61

Query: 61  NGYDISDYYAIMDEFGTMDDFDELLAQAHRRGLKVILDLVINHTSDEHPWFIESRSSRDN 120
           +GYD++DYY +   +GT+ DF E      +RG++VI+DLV+NHTSD+HPWF  +R   D+
Sbjct: 62  HGYDVADYYNVDPRYGTLGDFVEFSHACKQRGIRVIIDLVVNHTSDQHPWFQAARKDPDS 121

Query: 121 PKRDWYIWRDGKDGREPNNWESIFGG---SAWQYDERTGQYYLHIFDVKQPDLNWENSEV 177
           P RDWY+W D K   +  +   +F G   + W +D+    YY H F   QPDLN  N EV
Sbjct: 122 PYRDWYVWSDKKP--DDADQGVVFPGVQKTTWSWDKEARAYYFHRFYEFQPDLNTANPEV 179

Query: 178 RQALYEMVNWWLDKGIDGFRIDAISHIKKKPGLPDLPNPKGLKYVPSFAGHMNQPGIMEY 237
           +  L +++ +W++ G+ GFR+DA+  +    G PD+  PK             Q  ++  
Sbjct: 180 QAELLKVMGFWIELGVSGFRMDAVPFVIATKG-PDVKKPK------------QQFDMLRT 226

Query: 238 LRELKEQTFARYDIMTVGEANGV-TVDEAEQWVGEENGVFNMIFQFE-HLGLWERRADGS 295
            RE  +      D + + EAN + TVD  +++ G++     M+F F+ +  L+   A  +
Sbjct: 227 FREFVQWRCG--DAVLLAEANVLPTVD--QEYFGDDGDRMQMVFNFQVNQNLFYALA--T 280

Query: 296 IDVRRLKRTLTKWQKGLENRGWNALFLENHD-----------LPRSVSTWGNDRDY---- 340
            D R L + L   +    +     LFL NHD             R    +G D+D     
Sbjct: 281 ADTRPLAKALDVTRVPRPSTNQWGLFLRNHDELDLGRLTEAQRKRVFDAFGPDKDMQLYD 340

Query: 341 ----------------WAESAKALGALYFFMQGTPFIYQGQEIGMTNVRFDDIRDYRDVS 384
                           W E A    +L F + GTP +  G EIGM     DD        
Sbjct: 341 RGIRRRLAPMLRGDRRWLELAY---SLLFTLPGTPVLRYGDEIGMG----DD-------- 385

Query: 385 ALRLYELERAKGRTHEEAMTIIWKTGRDNSRTPMQWSGASNAGFTTGT----PWIKVNE- 439
            L L E                    R+ +RTPMQWS     GFT       P I     
Sbjct: 386 -LSLPE--------------------RECARTPMQWSDEPQGGFTKADDPVHPVISGGAY 424

Query: 440 NYRTINVEAERRDPNSVWSFYRQMIQLRKANELFVYGTYDLLLENHPSIYAYTRTLGRDR 499
            Y  IN   +RRDP+++ ++  ++I++RK      +G + +L     ++ A       + 
Sbjct: 425 GYERINAAHQRRDPSALLNWTERIIRMRKECPEIGWGDFQVLPTGSNAVLAIRYDWRNNS 484

Query: 500 ALVVVNLSDRP 510
            LVV NL DRP
Sbjct: 485 VLVVHNLDDRP 495


Lambda     K      H
   0.320    0.138    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1041
Number of extensions: 69
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 555
Length of database: 562
Length adjustment: 36
Effective length of query: 519
Effective length of database: 526
Effective search space:   272994
Effective search space used:   272994
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory