GapMind for catabolism of small carbon sources

 

Aligments for a candidate for susB in Azospirillum brasilense Sp245

Align α,α-trehalase / α-glucosidase (TTC0107) (EC 3.2.1.20|3.2.1.28) (characterized)
to candidate AZOBR_RS25735 AZOBR_RS25735 alpha-amylase

Query= CAZy::AAS80455.1
         (528 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS25735 AZOBR_RS25735
           alpha-amylase
          Length = 537

 Score =  588 bits (1515), Expect = e-172
 Identities = 299/539 (55%), Positives = 365/539 (67%), Gaps = 27/539 (5%)

Query: 2   WWKEAVIYQVYPRSFQDTNGDGVGDLEGVRRRLPYLKSLGVDALWLSPFYKSPMKDFGYD 61
           WW+  VIYQVYPRSFQD+NGDGVGDL G+  RL +L++LGVDALW+SP Y SPM DFGYD
Sbjct: 7   WWQSGVIYQVYPRSFQDSNGDGVGDLPGILARLDHLQTLGVDALWVSPIYPSPMADFGYD 66

Query: 62  VADYCDVDPVFGTLQDFDRLLEEAHALGLKVLVDLVPNHTSSEHPWFLESRASRNSPKRD 121
           V+DY  V P+FGT++DF+RLL E H  G+K+++D VPNH+S  HPWF  SR+SR+ PKRD
Sbjct: 67  VSDYTGVHPLFGTMEDFERLLAELHRRGMKLILDFVPNHSSDRHPWFQASRSSRDDPKRD 126

Query: 122 WYIWKDPAPDGGPPNNWQSFFGGPAWTLDEATGQYYLHQFLPEQPDLNWRNPEVREAIYE 181
           WYIW+D APDGGPPNNW S FGG AW  D ATGQYY H +L EQPDLNWRNP +REA+ +
Sbjct: 127 WYIWRDAAPDGGPPNNWLSEFGGGAWEWDAATGQYYYHAYLKEQPDLNWRNPALREAMLD 186

Query: 182 VMRFWLRRGVDGFRVDVLWLLAEDLLFRDEPGNPDWRPGMWDRGRHLHIFTEDQPETYAY 241
            +R WL RGVDGFRVD +  L +D  FRD P NP WR GM    R + + T DQPE +  
Sbjct: 187 ALRVWLDRGVDGFRVDAIHHLIKDAQFRDNPPNPGWREGMSPVRRLIRLHTVDQPEVHDA 246

Query: 242 VREMRQVLDEFSEPGRERVMVGEIYLPYPQLVRYYQA---GCHLPFNFHLIFRGLPDWRP 298
           +  MR+V D +   G +R+++GE YLP  QL+ YY A   G  LPFNFHL+      W  
Sbjct: 247 IAAMRRVADGY---GPDRLLIGEAYLPIDQLMAYYGADLTGFQLPFNFHLL---STPWEA 300

Query: 299 ENLARIVEEYESLLTRWDWPNWVLGNHDQPRLASRLGEAQARVAAMLLFTLRGTPTWYYG 358
           + LA ++  YE+ L    WPNWVLGNHD+ R+ASRLG  QARVAAMLL TLRGTPT Y G
Sbjct: 301 KALAALIRTYEAALPPGGWPNWVLGNHDRSRVASRLGRGQARVAAMLLLTLRGTPTLYQG 360

Query: 359 DEIGMKNGEIPPEKVQDPAALRQKDRLGEHNLPP---GRDPERTPMQWDDTPFAGFSTVE 415
           DEIGM +  IPP++VQDP          E N+P    GRDP RTP+ WD  P  GF+T E
Sbjct: 361 DEIGMTDVAIPPDRVQDP---------WEKNIPGLGLGRDPVRTPIPWDGGPRGGFTTGE 411

Query: 416 PWLPVNPDYKTRNVAAQEQDPRSMLHLVRRLIALRK-DPDLLYGAYRTYRAREGVYAYLR 474
           PWLP+ PD++  NVAAQ  DP SML L R L++LR+ +P L  G Y    A   V  Y R
Sbjct: 412 PWLPLGPDHERVNVAAQAADPSSMLALHRALLSLRRAEPALSVGRYEPVSAENDVLVYER 471

Query: 475 GEG---WLVALNLTEKEKALE-LPRGGRVVLSTHLDR-EERVGERLFLRPDEGVAVRLD 528
             G   + V LNL+  E+ ++ +P    + LSTHLDR  E V   L LRPDEGV +  D
Sbjct: 472 RHGRDRFRVLLNLSAAERTVDAVPDAAHIRLSTHLDRGGEPVSGALRLRPDEGVVIGFD 530


Lambda     K      H
   0.321    0.141    0.466 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1232
Number of extensions: 75
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 528
Length of database: 537
Length adjustment: 35
Effective length of query: 493
Effective length of database: 502
Effective search space:   247486
Effective search space used:   247486
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory