Align ThuE aka RB0311 aka SMB20325, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized)
to candidate AZOBR_RS25580 AZOBR_RS25580 ABC transporter substrate-binding protein
Query= TCDB::Q9R9Q7 (423 letters) >FitnessBrowser__azobra:AZOBR_RS25580 Length = 427 Score = 356 bits (914), Expect = e-103 Identities = 186/403 (46%), Positives = 257/403 (63%), Gaps = 2/403 (0%) Query: 23 AAAAELSMAANSTGKNLSFLRDQIARFEKETGHKVNLVTMPASSSEQFSQYRLWLAAGNK 82 AA A +++A + G + RD + + +G++V V+ P +SEQ + Y+ LAAG+ Sbjct: 25 AAGATVTLACSGLGISFDLCRDGAQEWARRSGNEVRFVSPPKGASEQLALYQQLLAAGSP 84 Query: 83 DVDVYQTDVIWAPQLAEQFVDLTE-ATKDVVGEHFPSIIQSQTVNGKLVALPFYTDAPAL 141 D+DV+Q DV+W L F+DL + A D VG H P++I++ TV G+LVA+P++ DA L Sbjct: 85 DIDVFQIDVVWPGILGNYFIDLKDRAGPDTVGRHLPAMIEAATVKGRLVAMPWFADAGVL 144 Query: 142 YYRKDLLDKYGKTPPKTWDELAATAKEVQDKERAAGSADIWGFVFQGNAYEGLTCNALEW 201 Y RKDLL+ +G+ P+TW+EL TA +Q ERAAG +WG+V+QG AYEGLT NALEW Sbjct: 145 YARKDLLEAHGRPVPQTWEELQDTAALIQRAERAAGRDRMWGYVWQGRAYEGLTVNALEW 204 Query: 202 IKSSGGGQIIEPDGTISVNNEKAAAAVEKVKEWIGTIAPKGVLAYQEEESRGVWQTGNAV 261 I S GG I+ PDG I+++N +AA A+ + W+G+I+P GVL Y EEE+RGV+Q+GNAV Sbjct: 205 IASRNGGTIVAPDGAITIDNPQAAEALAMARGWVGSISPPGVLNYMEEEARGVFQSGNAV 264 Query: 262 FMRNWPYAYALGNGDDSAVKGKFEVAPLPAATDGDQPSSTLGGWNLAVSKYSDEQEAAIA 321 FMRNWPYA+ L N DSAV GK V PLP + +STLGG LAVSK+S + A Sbjct: 265 FMRNWPYAWTLVNAADSAVGGKVAVVPLPKGGPEGRHTSTLGGQLLAVSKFSAHADEAAD 324 Query: 322 FVKFLGSAETQKVRAIELSNLPTIAALYDDPEVAAAQPFMPHWKPIFQSAVPRPSAVAKV 381 +L QK RAI ++ PTI ALY+D EV AA PF +AV RP+ + Sbjct: 325 LALYLTGLAEQKRRAIHGASNPTIPALYEDAEVVAANPFFAALAESIANAVNRPAQATGM 384 Query: 382 KYNEVSSKFWSAVHNTLSGNGTAAENLELLEVELTEL-KGDAW 423 +YN+VS++F++ VH LSG A L L+ L + +G W Sbjct: 385 RYNQVSAEFYANVHEVLSGRQDAKAMLSDLKEALVRISRGGRW 427 Lambda K H 0.313 0.129 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 418 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 423 Length of database: 427 Length adjustment: 32 Effective length of query: 391 Effective length of database: 395 Effective search space: 154445 Effective search space used: 154445 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory