Align ABC transporter for D-Trehalose, permease component 1 (characterized)
to candidate AZOBR_RS25585 AZOBR_RS25585 ABC transporter permease
Query= reanno::Smeli:SM_b20326 (328 letters) >FitnessBrowser__azobra:AZOBR_RS25585 Length = 301 Score = 379 bits (973), Expect = e-110 Identities = 187/304 (61%), Positives = 232/304 (76%), Gaps = 13/304 (4%) Query: 23 LQAQRVRSAWLFLAPTFLVLALVAGWPLIRTIYFSFTNASLTNLSGAEFVGFANYLSWIT 82 L QR R+AWLFL P +VLA VAGWPL RT++FSFT+A+L L G + VG NYL W Sbjct: 10 LMRQRRRAAWLFLLPMLIVLAGVAGWPLFRTVFFSFTDATLATLEGFQGVGLDNYL-W-- 66 Query: 83 LKSGRTIYRGLLADPAWWNAVWNTLKFTVLSVSIETALGLIVALVLNAQFPGRGLVRAAI 142 L+ DP WW AVWNTL FTV+SV IETALGL +AL+LNA PGRGL+RAA+ Sbjct: 67 ----------LMRDPVWWRAVWNTLVFTVVSVGIETALGLGIALILNAHLPGRGLLRAAV 116 Query: 143 LIPWAIPTIVSAKMWAWMLNDQFGILNDMLIGLGLIGEKIAWTASPDTAMIAELIVDVWK 202 LIPWAIPT+VSA+MW WM +D +G++N +L+GLGLI E AWTA PD A+ + VDVWK Sbjct: 117 LIPWAIPTVVSAQMWGWMFHDLYGVVNAILMGLGLIAEPRAWTADPDLALPVVIAVDVWK 176 Query: 203 TTPFMALLILAGLQMVPGDIYEAAKIDGVHPVRVFWRVTLPLIRPALMVAVIFRMLDALR 262 +TPFMALLILA LQM+P D+YEAA++DGVHPV+VF R+TLPLIRPALMVAV+FR LDALR Sbjct: 177 STPFMALLILAALQMLPRDLYEAARVDGVHPVKVFVRITLPLIRPALMVAVLFRTLDALR 236 Query: 263 IFDLIYVLTPNNAQTKTMSVMARENLFDFDKFAYGAAASTMLFLIIATITILYMWLGRLN 322 +FDL+YVLT N+ T +MSV AR+ L DF YG+AA+T+L L++A T+L + LGR+ Sbjct: 237 VFDLMYVLTGNSRSTMSMSVYARQYLIDFQDVGYGSAAATLLVLVLAVATVLAVTLGRVR 296 Query: 323 LSGG 326 + G Sbjct: 297 VDAG 300 Lambda K H 0.328 0.140 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 301 Length adjustment: 27 Effective length of query: 301 Effective length of database: 274 Effective search space: 82474 Effective search space used: 82474 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory