Align Mannitol-specific phosphotransferase enzyme IIA component, component of The mannitol porter (MtlA) (mannitol-1-P forming), MtlAF (characterized)
to candidate AZOBR_RS32325 AZOBR_RS32325 PTS fructose transporter subunit IIA
Query= TCDB::C0H3V2 (143 letters) >FitnessBrowser__azobra:AZOBR_RS32325 Length = 846 Score = 91.7 bits (226), Expect = 2e-23 Identities = 46/139 (33%), Positives = 78/139 (56%) Query: 3 VLAKENIKLNQTVSSKEEAIKLAGQTLIDNGYVTEDYISKMFEREETSSTFMGNFIAIPH 62 +L E ++L+ + + KEEAI+ A Q LI G + Y + M RE ++TF+G+ +AIPH Sbjct: 14 LLRPELLRLSASPAGKEEAIREAAQLLIAAGCIDSAYAASMLRREAVANTFLGHGVAIPH 73 Query: 63 GTEEAKSEVLHSGISIIQIPEGVEYGEGNTAKVVFGIAGKNNEHLDILSNIAIICSEEEN 122 G E + V SGI+++Q+P G+ + G TA +V IA +++ H+ +L + + +E Sbjct: 74 GMVEDRGMVRRSGIAVLQVPGGIAWNPGQTAHLVVAIAAQSDAHIAVLRRLTRLMQDEAR 133 Query: 123 IERLISAKSEEDLIAIFNE 141 + L + L A E Sbjct: 134 LTALFTVTDPAALAAALGE 152 Lambda K H 0.310 0.130 0.342 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 143 Length of database: 846 Length adjustment: 28 Effective length of query: 115 Effective length of database: 818 Effective search space: 94070 Effective search space used: 94070 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory