Align Probable NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; Short chain dehydrogenase/reductase; YlSDR; EC 1.1.1.138 (characterized)
to candidate AZOBR_RS16640 AZOBR_RS16640 3-hydroxybutyrate dehydrogenase
Query= SwissProt::Q6CEE9 (278 letters) >FitnessBrowser__azobra:AZOBR_RS16640 Length = 261 Score = 127 bits (320), Expect = 2e-34 Identities = 86/261 (32%), Positives = 140/261 (53%), Gaps = 19/261 (7%) Query: 30 SLKGKVASITGSSSGIGFAVAEAFAQAGADVAI--WYNSKPSDEKAEYLSKTYGVRSKAY 87 +L KVA +TGS+SGIG +A A A AGADV + + + +E L+ +GVR + Sbjct: 2 TLTQKVAVVTGSTSGIGLGIARALAGAGADVVLNGFGEAAAIEELRAGLAAEFGVRVGYH 61 Query: 88 KCAVTNAKQVETTIQTIEKDFGKIDIFIANAGIPWTAGPMIDVPNNEEWDKVVDLDLNGA 147 ++ ++ I E+ FG +D+ + NAGI A P+ D P E WD V+ L+L+ Sbjct: 62 GADLSKPAEIAALIGHAEETFGSVDVLVNNAGIQHVA-PVEDFP-AERWDAVIALNLSAV 119 Query: 148 YYCAKYAGQIFKKQGYGSFIFTASMSGHIVNIPQMQACYNAAKCAVLHLSRSLAVEWAGF 207 ++ +A K++G+G + AS+ GH+ ++ ++ Y AAK V+ L++++A+E AG Sbjct: 120 FHGTHHALPGMKRRGWGRILNIASVHGHVASV--NKSAYVAAKHGVVGLTKTVALETAGT 177 Query: 208 -ARCNTVSPGYMATEI----SDFI--------PRDTKEKWWQLIPMGREGDPSELAGAYI 254 CN + PG++ T + D I P+ E P G P EL G + Sbjct: 178 GVTCNAICPGWVLTPLVQKQIDAIASTKNIPEPQAKAELLGAKQPSGAFVTPDELGGLAV 237 Query: 255 YLASDASTYTTGADILVDGGY 275 +L SD++ TGA +L+DGG+ Sbjct: 238 FLCSDSAAQMTGASLLMDGGW 258 Lambda K H 0.317 0.132 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 261 Length adjustment: 25 Effective length of query: 253 Effective length of database: 236 Effective search space: 59708 Effective search space used: 59708 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory