Align TM1747, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate AZOBR_RS26245 AZOBR_RS26245 ABC transporter permease
Query= TCDB::Q9X269 (341 letters) >FitnessBrowser__azobra:AZOBR_RS26245 Length = 305 Score = 177 bits (448), Expect = 4e-49 Identities = 113/318 (35%), Positives = 174/318 (54%), Gaps = 17/318 (5%) Query: 25 LKFLLKRLLTIAISMVVVIVITYVLMWLAPGNFFELQRVRDAIARVTTPDDPAYQATLKG 84 L + LKRLL + V V V G+F L+ D V A + ++ Sbjct: 2 LAYSLKRLLLAVLVAVTVSV----------GSFALLRAAGDPA--VAMAGHSATASDIEF 49 Query: 85 FEERYGLNNPLWKQILMYLKGAVVFKFGPS--FSDPARNIEDLIKEKFPITFTLALSSIL 142 E YG N PL Q +L A+ FG S F P + ++ +K P T TL ++ Sbjct: 50 IRETYGFNRPLPVQYADWLVKALQGDFGESLYFRMP---VSRMLADKLPTTMTLGGLALA 106 Query: 143 FALVVGVPLGILAALKKNTWIDYTAMTVSVIGVAIPSYVVAVFLILIFSIYLGWLPTSGW 202 FAL VG+PLGI+AA++ N+WID A+ VSV G A+P++ A+ L+++FSI LP SG Sbjct: 107 FALCVGLPLGIIAAIRPNSWIDRAALLVSVTGQAMPTFWFALVLVVLFSITFPLLPPSGS 166 Query: 203 EGIRTKILPTIALALGPLASVARFTRVSLLDTLNQDFIRTAYAKGGDDRTVIMKHALRPS 262 + ++PT+ L ++ R TR +L+ L D+IRTA AKG V++KHALR + Sbjct: 167 GTWKHFVMPTVVLGYYATPAIMRLTRAGMLEVLASDYIRTARAKGLHPAVVLLKHALRNA 226 Query: 263 MIPLVTIVGPQMAYLMVGTVWVENIFRIPGLGQLFANAAVTRDYPLLVTSTFILALTVMI 322 +IP+V++ Q +++ G+V VE +F + G GQL + D P + +L+ ++ Sbjct: 227 VIPVVSLSAVQFGFMLGGSVVVETVFALHGTGQLAWESISRSDLPTVQAIVLVLSSFYVV 286 Query: 323 MNLIVDVLYAILDPRIKL 340 ++LI D+L A LDPRI++ Sbjct: 287 LSLIADLLNAWLDPRIRV 304 Lambda K H 0.328 0.143 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 305 Length adjustment: 28 Effective length of query: 313 Effective length of database: 277 Effective search space: 86701 Effective search space used: 86701 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory