Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate AZOBR_RS21780 AZOBR_RS21780 peptide ABC transporter ATP-binding protein
Query= TCDB::Q9X272 (328 letters) >FitnessBrowser__azobra:AZOBR_RS21780 Length = 326 Score = 282 bits (722), Expect = 7e-81 Identities = 138/315 (43%), Positives = 215/315 (68%), Gaps = 8/315 (2%) Query: 13 LLQTVDLKKYFPQGK------RILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKL 66 +L+ + L+K++ + +KA+DG+S +++ G+TL +VGESGCGKSTL R++ + Sbjct: 8 VLEAIHLRKHYAVKRGAFKPAATVKALDGVSFQLEAGKTLAVVGESGCGKSTLARSVTMI 67 Query: 67 LRPDGGKIFFEGKDITNLNDKEMKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKI 126 P G++ ++G+D+ EMK R+ +Q++FQ+P GSLNP+ TVG I+ +PL+I+ Sbjct: 68 EPPSSGQLLYDGRDVVGRTASEMKELRRTVQMVFQNPYGSLNPRKTVGSILSEPLVINTP 127 Query: 127 GTKKERRKRVEELLDMVGIGREFINSFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSA 186 K+ERR+R ++ VG+ + ++ +PH FSGGQ+QRI IARAL LNP+ +V DEPVSA Sbjct: 128 MGKQERRERAVAMMAKVGLRPDQVDRYPHMFSGGQRQRIAIARALMLNPRVVVADEPVSA 187 Query: 187 LDVSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKIFL 246 LDVSIQAQ+++L+ ++Q+++ ++YLFI+H+L+VV HI+ V VMYLG+ VE+G D ++ Sbjct: 188 LDVSIQAQVLNLMMDLQEELNLAYLFISHDLSVVRHIADAVMVMYLGRPVEHGPKDVVYS 247 Query: 247 NPIHPYTRALLKSVPKIPWDGQKQRFYSLKGELPSPIDLPKGCRFQTRCTEKKAICFEKE 306 P HPYTR L+ + P++ + +R KGELPSP++ P GC F RC C + Sbjct: 248 RPRHPYTRILMAATPRVNPALRAERVIP-KGELPSPLNPPPGCPFHKRCPYATERCATEV 306 Query: 307 PELTEVEKNHFVSCH 321 P L V++ V+CH Sbjct: 307 PALRPVDE-RLVACH 320 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 326 Length adjustment: 28 Effective length of query: 300 Effective length of database: 298 Effective search space: 89400 Effective search space used: 89400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory