Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate AZOBR_RS31025 AZOBR_RS31025 peptide ABC transporter ATP-binding protein
Query= TCDB::Q9X272 (328 letters) >FitnessBrowser__azobra:AZOBR_RS31025 Length = 335 Score = 281 bits (719), Expect = 2e-80 Identities = 133/295 (45%), Positives = 196/295 (66%), Gaps = 2/295 (0%) Query: 28 RILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLLRPDGGKIFFEGKDITNLNDK 87 R ++AV G+ + I EGE +GLVGESGCGKSTLGR + +L P G + + G+D+ L+ Sbjct: 37 RAVQAVSGVDLSIAEGEVVGLVGESGCGKSTLGRMVAGILPPSAGTLRWRGRDLRELSPA 96 Query: 88 EMKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKIGTKKERRKRVEELLDMVGIGR 147 + K+Q++FQDP+ SLNP++ V I+ + ++H + ++E V L VG+ Sbjct: 97 DRHHANLKIQMVFQDPMASLNPRLRVADIVGEAPVVHGLVPRREAEDYVAATLRQVGLDP 156 Query: 148 EFINSFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSALDVSIQAQIIDLLEEIQQKMG 207 ++ +PH+FSGGQ+QRIGIARALA+ P +VCDE V+ALDVSIQAQII+L +++++ Sbjct: 157 AYLRRYPHQFSGGQRQRIGIARALAVKPDVLVCDESVAALDVSIQAQIINLFMRLREELS 216 Query: 208 ISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKIFLNPIHPYTRALLKSVPKIPWDG 267 ++YLFI+H+L VVEHIS + A+MYLG+IVE ++F P HPY +ALL P++ Sbjct: 217 LTYLFISHDLGVVEHISDRTAIMYLGRIVELAPTPELFDKPNHPYAKALLDEAPRV--SV 274 Query: 268 QKQRFYSLKGELPSPIDLPKGCRFQTRCTEKKAICFEKEPELTEVEKNHFVSCHL 322 +K+RF ++GE+PSP+D P GC F RC C + P L E+ + +CHL Sbjct: 275 EKRRFAPIRGEIPSPLDPPSGCAFHPRCPHAMPRCSAERPALREIAPRRWSACHL 329 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 335 Length adjustment: 28 Effective length of query: 300 Effective length of database: 307 Effective search space: 92100 Effective search space used: 92100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory