Align Inositol 2-dehydrogenase (EC 1.1.1.18) (characterized)
to candidate AZOBR_RS22955 AZOBR_RS22955 oxidoreductase domain protein (fragment)
Query= reanno::WCS417:GFF2329 (336 letters) >FitnessBrowser__azobra:AZOBR_RS22955 Length = 608 Score = 57.4 bits (137), Expect = 9e-13 Identities = 63/195 (32%), Positives = 89/195 (45%), Gaps = 23/195 (11%) Query: 4 KLGVIGTGAIGRDHIRRCSQTL--LNSQVVAVTDINLEQAAKVVADLNISAEVYADGHAL 61 +L +IG G+I H+ L S +V T LE A + + N + AD Sbjct: 8 RLAIIGCGSIVSHHLLPALLRLGWRPSVLVDPTPGRLE-AVQAMLGRNRAPVAVADWREA 66 Query: 62 IHSPEVEAVLVTSWGPSHEEFVLAAIAAGKPVFCEKPLAVT-AEGCRKIVDAEVAFGKRL 120 + + +A LV + H + + AGK VF EKPLAV A+ R AE +R+ Sbjct: 67 --ADQFDAALVAAPPMLHAPVGQSLLEAGKHVFMEKPLAVALADAERMAQTAEER--RRV 122 Query: 121 VQVGFMRPYDDGYRALKAVIDSGQIGEPLMLHCAH--------RNPTVGENYKTDMA--- 169 + VG MR Y +G R LKA+IDSGQ+G L +P + + D A Sbjct: 123 LAVGLMRRYVNGVRWLKALIDSGQLGRVLRFEAREGFVYNWGISSPAM---LRRDGAGGG 179 Query: 170 -ITDTLIHELDVLRW 183 + DT H LD+L W Sbjct: 180 VLLDTGSHTLDLLLW 194 Lambda K H 0.320 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 428 Number of extensions: 26 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 608 Length adjustment: 33 Effective length of query: 303 Effective length of database: 575 Effective search space: 174225 Effective search space used: 174225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory