Align crotonase (EC 4.2.1.150) (characterized)
to candidate AZOBR_RS18155 AZOBR_RS18155 enoyl-CoA hydratase
Query= metacyc::MONOMER-13469 (259 letters) >FitnessBrowser__azobra:AZOBR_RS18155 Length = 248 Score = 166 bits (421), Expect = 3e-46 Identities = 101/257 (39%), Positives = 143/257 (55%), Gaps = 18/257 (7%) Query: 11 DGNVASITLNRPKALNALNAATLKEIDAAINDIAEDDNVYAVIITGSG-KAFVAGADIAE 69 DG VA+ITL+RP+ LNA+ ++ AA+ DD++ V++TG+G +AF G+DI E Sbjct: 2 DGFVATITLDRPQKLNAVTPEMAAQLVAAVARCNADDDIRCVVLTGAGPRAFCCGSDIRE 61 Query: 70 MKDLTAVEGRKFSVLGNKIFRKLEN-------LEKPVIAAINGFALGGGCELSLSCDIRI 122 + ++ N FR E+ L KP IAA+NG+A GGG E ++SCDIRI Sbjct: 62 LD--------RYDTAWN--FRNREDYCDAIRGLRKPSIAAVNGYAFGGGLETAMSCDIRI 111 Query: 123 ASSKAKFGQPEVGLGITPGFGGTQRLARAIGVGMAKELIYTGKVINAEEALRIGLVNKVV 182 AS A+FG PE+ LG G G L+ +IG A +I TG I A++AL GLV++VV Sbjct: 112 ASENAQFGAPEIKLGWIGGGGVAAFLSHSIGTSNAAMMILTGDPIPADKALAWGLVSEVV 171 Query: 183 EPDKLLEEAKALVDAIIVNAPIAVRMCKAAINQGLQCDIDTGVAYEAEVFGECFATEDRV 242 D+LL A+ + + APIA K + ++ + YE ++ CFAT D Sbjct: 172 PADRLLARAQEIAAIVASRAPIAAETAKLNLKAAHTMPVEKAIEYERDLQTICFATADAA 231 Query: 243 EGMTAFVEKRDKAFKNK 259 EG AF EKR F+ K Sbjct: 232 EGRAAFKEKRSPVFRRK 248 Lambda K H 0.318 0.136 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 248 Length adjustment: 24 Effective length of query: 235 Effective length of database: 224 Effective search space: 52640 Effective search space used: 52640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory