Align pimeloyl-CoA dehydrogenase large subunit (EC 1.3.1.62) (characterized)
to candidate AZOBR_RS29205 AZOBR_RS29205 acyl-CoA dehydrogenase
Query= metacyc::MONOMER-20676 (396 letters) >FitnessBrowser__azobra:AZOBR_RS29205 Length = 381 Score = 177 bits (450), Expect = 3e-49 Identities = 124/356 (34%), Positives = 183/356 (51%), Gaps = 27/356 (7%) Query: 45 EWYRILNKKGWAVTHWPKEYGGTGWSSVQHYIFNEELQAAPAPQPLAFGVS-MVGPVIYT 103 E+ R L ++GW WPK+YGG S+++ Y+ EEL AA AP + GP++ Sbjct: 48 EFSRKLGQRGWIGMAWPKQYGGHERSALERYVVLEELLAAGAPVAAHWIADRQSGPLLLK 107 Query: 104 FGSEEQKKRFLPRIANVDDWWCQGFSEPGSGSDLASLKTKAEKKGDKWIINGQKTWTTLA 163 G+EEQK+ LPRIA + ++C G SEP SGSDLA+++T+A W +NG K WTT A Sbjct: 108 VGTEEQKRSILPRIAAGEFFFCIGMSEPDSGSDLAAVRTRAVPVEGGWRVNGTKLWTTYA 167 Query: 164 QHADWIFCLCRTDPAAKKQEGISFILVDMKTKGITVRPIQTIDGGHEVNEVFFDDVEVPL 223 HA + CRT A + G S LVD+ GIT+RPI + G NEV F+DV +P Sbjct: 168 HHAHAMILYCRTGAADDRHGGTSQFLVDLTLPGITIRPIADLSGARHFNEVVFEDVLLPH 227 Query: 224 ENLVGQENKGWDYAKFLLGNERTGIAR-VGMSKERIRRIKQLAAQVESGGKPVIEDPKFR 282 L+GQE GW+ L ER+G R + + ++ L +Q+ P Sbjct: 228 SALIGQEGDGWNQVMSELAYERSGPERFMSTFVLFVELVRALGSQM---------TPDAA 278 Query: 283 DKLAAVEIELKALELTQLRVVADEGKHGKGKPNPA--SSVLKIKGSEIQQATTELLMEVI 340 L + + L L R VA + G+ NPA +SV+K G+ ++Q E+ +++ Sbjct: 279 GALGRLGVHLVVLRRLS-RSVAGMLQDGR---NPALQASVVKDLGALVEQEIPEIARQLM 334 Query: 341 GPFAAPYDVHGDDDSNETMDWTAQIAPGYFNNRKVSIYGGSNEIQRNIICKAVLGL 396 A D+ D + + ++ AP + S+ GG+ EI R II + LGL Sbjct: 335 ---AMEPDLRSHDALSAVLGYSILNAPAF------SLRGGTREILRGIIARG-LGL 380 Lambda K H 0.317 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 381 Length adjustment: 30 Effective length of query: 366 Effective length of database: 351 Effective search space: 128466 Effective search space used: 128466 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory