Align phenylpyruvate decarboxylase (EC 4.1.1.43) (characterized)
to candidate AZOBR_RS22245 AZOBR_RS22245 pyruvate dehydrogenase E1 subunit alpha
Query= BRENDA::A0A222AKA3 (368 letters) >FitnessBrowser__azobra:AZOBR_RS22245 Length = 338 Score = 120 bits (300), Expect = 7e-32 Identities = 88/309 (28%), Positives = 145/309 (46%), Gaps = 15/309 (4%) Query: 46 YRAMVVGRAFNRQATAFSRQGRLAVYPSSR-GQEACQVGSALAVRPTDWLFPTYRESVAL 104 YR M++ R F +A G + + GQEA VG A++ D + +YR+ + Sbjct: 29 YREMLLIRRFEEKAGQLYGMGLIGGFCHLYIGQEAVVVGIQAALKDNDDVITSYRDHGHM 88 Query: 105 LTRGIDPVQVLTLFRGDQHCGYDPVTEHTAPQCTP----------LATQCLHAAGLADAA 154 L G+DP V+ G + GY + + + Q GLA + Sbjct: 89 LACGMDPKGVMAELTG-RRGGYSKGKGGSMHMFSREKNFYGGHGIVGAQVPLGTGLAFSH 147 Query: 155 RMAGDPIVALAYIGDGATSEGDFHEALNYAAVRRAPVVFLVQNNQYAISVPLAKQTAART 214 + D ++ Y GDGA ++G +E+ N AA+ + PV+++++NN+YA+ + +A Sbjct: 148 KYNKDDGLSAVYCGDGAINQGQVYESFNMAALWKLPVLYVIENNKYAMGTSQERASAGE- 206 Query: 215 LADKAAGYGMPGVRIDGNDVLQVYRAVHDAAERARAGHGPTLIEAVTYRIDAHTNADDDT 274 L + A YG+PG +++G DVL+V A E RAG+GP ++E TYR H + D Sbjct: 207 LHQRGAAYGIPGHQVNGMDVLEVREAADKWVEYIRAGNGPVILEMKTYRYRGH-SMSDPA 265 Query: 275 RYRPAGEADVWAAQ-DPVDRLERDLLAAGVLDRAAADGIAAAADAFAGELSARFSAPPTG 333 +YR E + ++ DP+D L+R LL + I A E + P Sbjct: 266 KYRTKEEVEKMRSESDPIDNLKRVLLEGAYVTEDQLKEIDREVKAVVTEAAEFAQQSPEP 325 Query: 334 DPMQMFRHV 342 DP +++ V Sbjct: 326 DPAELWTDV 334 Lambda K H 0.319 0.132 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 338 Length adjustment: 29 Effective length of query: 339 Effective length of database: 309 Effective search space: 104751 Effective search space used: 104751 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory