Align BadK (characterized)
to candidate AZOBR_RS18155 AZOBR_RS18155 enoyl-CoA hydratase
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__azobra:AZOBR_RS18155 Length = 248 Score = 149 bits (376), Expect = 5e-41 Identities = 100/252 (39%), Positives = 137/252 (54%), Gaps = 11/252 (4%) Query: 12 GRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAG-NTRAFAAGADIASM 70 G V ITL+RP LNA+ + L A+ +ADD I +V+ G RAF G+DI + Sbjct: 3 GFVATITLDRPQKLNAVTPEMAAQLVAAVARCNADDDIRCVVLTGAGPRAFCCGSDIREL 62 Query: 71 AAWSYSDVYGSNFITRNWE----TIRQIRKPVLAAVAGLAYGGGCELALACDIVIAGRSA 126 D Y + + RN E IR +RKP +AAV G A+GGG E A++CDI IA +A Sbjct: 63 ------DRYDTAWNFRNREDYCDAIRGLRKPSIAAVNGYAFGGGLETAMSCDIRIASENA 116 Query: 127 KFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRVVDDDRL 186 +F PEIKLG + G G L +IG + A M L+ P+ A++A +GLVS VV DRL Sbjct: 117 QFGAPEIKLGWIGGGGVAAFLSHSIGTSNAAMMILTGDPIPADKALAWGLVSEVVPADRL 176 Query: 187 RDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADAREGIQA 246 +A +A+ + A K +L A + + I +ER FA+ADA EG A Sbjct: 177 LARAQEIAAIVASRAPIAAETAKLNLKAAHTMPVEKAIEYERDLQTICFATADAAEGRAA 236 Query: 247 FLEKRAPCFSHR 258 F EKR+P F + Sbjct: 237 FKEKRSPVFRRK 248 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 116 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 248 Length adjustment: 24 Effective length of query: 234 Effective length of database: 224 Effective search space: 52416 Effective search space used: 52416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory