Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate AZOBR_RS32405 AZOBR_RS32405 ABC transporter
Query= uniprot:A0A165KC86 (260 letters) >FitnessBrowser__azobra:AZOBR_RS32405 Length = 255 Score = 217 bits (552), Expect = 2e-61 Identities = 117/251 (46%), Positives = 161/251 (64%), Gaps = 3/251 (1%) Query: 6 NEVVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGT 65 + +L + G+++RFGGL A+SDV TI +G++ GLIGPNGAGKTT FN+ITG P GT Sbjct: 2 SNTLLSIQGLTRRFGGLLAVSDVSATIAKGELVGLIGPNGAGKTTLFNLITGFTPPSDGT 61 Query: 66 FELAGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTK 125 G+ ++A+ G+ RTFQN+R+F MT +NV VG G + A+ Sbjct: 62 VTFDGQDVTGRKPWQIARMGMGRTFQNLRVFPNMTVFDNVSVGAVGAFGQSPWRALINGG 121 Query: 126 GFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPA 185 A A+++R+ E L+ VG+ A A LSYG ++ LEIARALAT P+L+ LDEPA Sbjct: 122 ---AHSRAVSERSWEALERVGLTAQAGDIAANLSYGKRKYLEIARALATAPRLLILDEPA 178 Query: 186 AGMNATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQ 245 AG+N TE +L + I R+ T+LL+EHD+ LVMG C RV VL G++IA+G P VQ Sbjct: 179 AGLNDTETAELADFIRRLHAGGVTVLLVEHDMGLVMGSCSRVIVLASGRKIADGTPEAVQ 238 Query: 246 KNEKVIEAYLG 256 ++ V+EAYLG Sbjct: 239 RDPAVLEAYLG 249 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 255 Length adjustment: 24 Effective length of query: 236 Effective length of database: 231 Effective search space: 54516 Effective search space used: 54516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory