GapMind for catabolism of small carbon sources

 

Aligments for a candidate for livM in Azospirillum brasilense Sp245

Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate AZOBR_RS32410 AZOBR_RS32410 branched-chain amino acid ABC transporter permease

Query= uniprot:A0A165KER0
         (358 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS32410 AZOBR_RS32410
           branched-chain amino acid ABC transporter permease
          Length = 355

 Score =  186 bits (471), Expect = 1e-51
 Identities = 109/334 (32%), Positives = 180/334 (53%), Gaps = 45/334 (13%)

Query: 12  AVALLVLPLILQSFGNAWV-RIADLALLYVLLALGLNIVVGYAGLLDLGYVAFYAVGAYL 70
           AVA   +P  +   G++++ +IA   +++V+L+  LN V G AGLL +G+ AFY +GAY 
Sbjct: 36  AVAFGAVPAAIVGTGSSYLAQIAITTMIFVILSASLNHVTGTAGLLSIGHAAFYGIGAYA 95

Query: 71  FALMASPHLADNFAAFAAMFPNGLHTSLWIVIPVAALLAAFFGAMLGAPTLKLRGDYLAI 130
            AL+++                 L     + +P A L+AA FG ++  PT++L   Y A+
Sbjct: 96  AALLSTK----------------LGLPFIVTLPAAGLIAALFGFLVALPTMRLVSIYFAV 139

Query: 131 VTLGFGEIIRIFLNNLDHPVNLTNGPKGLGQIDSVKVFGLDLGKRLEVFGFDINSVTLYY 190
            TLG GE+I + L N    V++T GP G+  I  +           E+FG+  +++   Y
Sbjct: 140 ATLGIGEMIYVVLLNW---VDVTRGPMGIRGIPPI-----------ELFGWQADTLLTRY 185

Query: 191 YLFLVLVVVSVIICYRLQDSRIGRAWMAIREDEIAAKAMGINTRNMKLLAFGMGASFGGV 250
               V+ V  V + +RL  S  G A  A+RED+  A +MGIN   +K+ +F +   F G+
Sbjct: 186 LAVAVIAVACVWVLHRLTHSYYGNALRALREDDQCADSMGINVERLKIESFVVATFFAGI 245

Query: 251 SGAMFGAFQGFVSPESFSLMESVMIVAMVVLGGIGHIPGVILGAVLLSALPEVLRYVAGP 310
           +GA+      +++P++F  MES++I+AMVV+GG+G +PG ++GA+ +  LPE LR     
Sbjct: 246 AGALLAHTSAYIAPDNFRFMESILILAMVVVGGLGSLPGAVVGALFMIVLPEALR----- 300

Query: 311 LQAMTDGRLDSAILRQLLIALAMIIIMLLRPRGL 344
                    D    R + +   M + +LL P+G+
Sbjct: 301 ---------DIGDYRMIAVGATMFLSILLLPKGM 325


Lambda     K      H
   0.328    0.144    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 336
Number of extensions: 16
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 358
Length of database: 355
Length adjustment: 29
Effective length of query: 329
Effective length of database: 326
Effective search space:   107254
Effective search space used:   107254
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory