GapMind for catabolism of small carbon sources

 

Aligments for a candidate for AZOBR_RS08240 in Azospirillum brasilense Sp245

Align Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale)
to candidate AZOBR_RS25635 AZOBR_RS25635 high-affinity branched-chain amino acid ABC transporter (permease protein) (fragment)

Query= uniprot:G8ALI9
         (505 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS25635 AZOBR_RS25635
           high-affinity branched-chain amino acid ABC transporter
           (permease protein) (fragment)
          Length = 328

 Score =  203 bits (516), Expect = 8e-57
 Identities = 117/293 (39%), Positives = 167/293 (56%), Gaps = 23/293 (7%)

Query: 175 IGILLLTYIMLGWGLNIVVGLAGLLDLGYVAFYAVGAYSYALLAHYFGFSFWVCLPLAGF 234
           I  L L +I+L   +++V G+AGLL LG+ AFY VGAY+ ALL+  FG  F V LPL+G 
Sbjct: 30  IANLALIFILLSASMHLVTGVAGLLHLGHAAFYGVGAYTAALLSTKFGLGFTVTLPLSGL 89

Query: 235 LAAMSGVLLGFPVLRLRGDYFAIVTLGFGEIIRIILINWYQFTGGPNGISGIPRPSFFGI 294
           +AA+   L+  P +RL   YFA+ TL  G+++ ++++NW +FT GPNGI        FG 
Sbjct: 90  VAALIAFLVALPTMRLVSIYFAVATLAIGQMLYLVMLNWVEFTKGPNGIIVTKGLELFG- 148

Query: 295 ADFTRTPAEGTAAFHEMFGLEFSPLHRIIFLYYLILVLALVVNLFTMRVRKLPLGRAWEA 354
                                FS   R+   Y +  V+AL V L   R+     G A  +
Sbjct: 149 ---------------------FSLSGRLATYYTVATVVALCV-LAIGRLSHSYYGNALRS 186

Query: 355 LREDDIACASLGINRTNMKLAAFAIAAMFGGFAGSFFATRQGFISPESFTFIESAIILAI 414
           +REDD    ++G++   +K+ AF ++A F G AGS +A   G+ISP  F F ES +ILA+
Sbjct: 187 IREDDQCADAMGVSTARLKMEAFTLSAFFAGVAGSLWAHMTGYISPGDFKFSESILILAM 246

Query: 415 VVLGGMGSQIGVVVAAFLVIGLPEAFRELADYRMLAFGMGMVLIMLWRPRGLL 467
           VV+GG+GS  G V+ A L+I LPE  R   D+R +  G+ M L +L  P+GLL
Sbjct: 247 VVVGGLGSLPGAVIGALLLILLPEGLRAFGDFRNIMVGLVMFLSILLLPKGLL 299


Lambda     K      H
   0.329    0.144    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 438
Number of extensions: 17
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 505
Length of database: 328
Length adjustment: 31
Effective length of query: 474
Effective length of database: 297
Effective search space:   140778
Effective search space used:   140778
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory