Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate AZOBR_RS13300 AZOBR_RS13300 hypothetical protein
Query= uniprot:D8IUY4 (309 letters) >FitnessBrowser__azobra:AZOBR_RS13300 Length = 291 Score = 188 bits (478), Expect = 1e-52 Identities = 103/297 (34%), Positives = 178/297 (59%), Gaps = 20/297 (6%) Query: 10 NGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLKVVQQVAPGLPGIVQ 69 +G+ G++YAL+A+G + Y INF+HG++ M+G + +L V LP IV Sbjct: 8 SGITSGALYALVAVGLVLCYRTTGHINFSHGELFMIGGFLAFTL-----HVMWELPYIV- 61 Query: 70 LVIAIVGAIPVCIVVSLLIERIAYRPLRNAPRLAPLITAIGVSILLQTLAMMIWGRSP-- 127 A++GA+ V+ +L +R+ Y+PL AP +A ++ +G+S +L+ + WG Sbjct: 62 ---ALLGAVAGSFVLGVLTDRVVYQPLIKAPPIAMVMATVGLSFVLKGIGRHFWGGQGEV 118 Query: 128 LPFPQVMPSDPVHIAGALISPTQIMLLALAVLAMVGLVLIVEKTKMGRAMRATAENPRIA 187 +PFP ++ PV I G + P Q++++A + M+ L L +T+ G+ M+ATAEN A Sbjct: 119 VPFPPLVSPAPVLIGGVAVFPQQLVVIASVAVCMLLLTLFFTRTRAGKMMQATAENAHAA 178 Query: 188 GLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAFSAAVLGGIGNI 247 L+G+ +V ++T+ GA LA +A V + A + +G LKAF+A +LGG+G++ Sbjct: 179 YLVGIRVERVYMLTWGAGAALAGVAAV-FVAPLTLLTPDIGLSLLLKAFAATILGGLGSM 237 Query: 248 YGAMLGGILLGLIESLGAGYIGDLTGNFLGSNYQDIFAFIVLIIVLTLRPSGIMGER 304 GA++GG+L+G++E+ L G ++ S+ QD+ AFI+++ VL RP+G++G R Sbjct: 238 TGAVIGGLLVGILEA--------LAGTYIASSIQDVSAFIIILAVLVFRPTGLLGAR 286 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 291 Length adjustment: 27 Effective length of query: 282 Effective length of database: 264 Effective search space: 74448 Effective search space used: 74448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory