Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate AZOBR_RS29670 AZOBR_RS29670 ABC transporter permease
Query= uniprot:D8IUY4 (309 letters) >FitnessBrowser__azobra:AZOBR_RS29670 Length = 290 Score = 189 bits (481), Expect = 5e-53 Identities = 106/307 (34%), Positives = 173/307 (56%), Gaps = 20/307 (6%) Query: 1 MDIFIQQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLKVVQQV 60 ++ +Q ++N +VLG YAL+ +G T+++G++ ++NF HG++ GA + L ++ Sbjct: 1 VEAHLQHLLNAVVLGGTYALLGIGLTLIFGIMRVVNFTHGELYTFGAYMAYMLAGMM--- 57 Query: 61 APGLPGIVQLVIAIVGAIPVCIVVSLLIERIAYRPLRNAPRLAPLITAIGVSILLQTLAM 120 GL + L +A V + + + LIE RPL+ A ++ IG I +Q Sbjct: 58 --GLNFFMSLAMAAV----LGMALGALIEFTLLRPLKGADIDTTMLVMIGAGIAMQAGEQ 111 Query: 121 MIWGRSPLPFPQVMPSDPVHIAGALISPTQIMLLALAVLAMVGLVLIVEKTKMGRAMRAT 180 ++WG P P++PV + + ++ +L +A+L + G L++ +TK+G AMRAT Sbjct: 112 LVWGGVAKSVPSPFPTEPVVLGSVSVGMNRLFVLGVALLLLGGFYLLINRTKLGVAMRAT 171 Query: 181 AENPRIAGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAFSAAV 240 ++P A LMGV+ + +TFA+G+GLAA AG + + MG + LKAF+ + Sbjct: 172 FQDPDTAALMGVNRGLMYTLTFALGSGLAATAGALLGPIFVVTP-TMGDLVALKAFAIVI 230 Query: 241 LGGIGNIYGAMLGGILLGLIESLGAGYIGDLTGNFLGSNYQDIFAFIVLIIVLTLRPSGI 300 LGG+GNI GA +GG +L L E GAGY L S Y+D F+++I VL +RP G+ Sbjct: 231 LGGLGNIPGATIGGFVLALAEEFGAGY--------LSSGYRDAMGFLLIIAVLIVRPQGL 282 Query: 301 --MGERV 305 M ER+ Sbjct: 283 FAMKERI 289 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 290 Length adjustment: 27 Effective length of query: 282 Effective length of database: 263 Effective search space: 74166 Effective search space used: 74166 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory