Align AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate AZOBR_RS18065 AZOBR_RS18065 amino acid ABC transporter permease
Query= TCDB::Q52814 (384 letters) >FitnessBrowser__azobra:AZOBR_RS18065 Length = 219 Score = 103 bits (258), Expect = 3e-27 Identities = 65/208 (31%), Positives = 112/208 (53%), Gaps = 12/208 (5%) Query: 178 TLVLSFVGIAVSLPVGILLALGRRSRMPVIRMLCVTFIEVIRGVPLITVLFMASVMLPLF 237 T+VLS V +G+ L R + RM ++E+ +G PL+ LF+A L LF Sbjct: 20 TVVLSLVSFIGGGLLGMALLYLRIGKARAGRMFVQGYVELFQGTPLLMQLFLAFFGLGLF 79 Query: 238 LPTGWNVDKLLRALIGVSIFTSAYMAEVIRGGLQAIPKGQFEGADSLGLGYWQKTRLIIM 297 G +V L A + + ++T+A++ E+ RG ++++ +GQ+E + SLG+GY Q+ R +I+ Sbjct: 80 ---GIDVPAWLAAGLALVLWTAAFLVEIWRGCVESVARGQWEASASLGMGYVQQMRYVIL 136 Query: 298 PQAIKLVIPSIVNTFIGTFKDTSLVTIIGMFDL--LGIVKLNFSDANWASAVTPITGLIF 355 PQA+++ +P V + K T+L +IIG +L G V N + P T Sbjct: 137 PQAVRVAVPPTVGFSVQVVKGTALTSIIGFVELSKAGTVVTN-------ATFEPFTVYGL 189 Query: 356 AGFIFWLFCFGMSRYSGFMERHLDTGHK 383 I++ C+ +S+ S +ER L+ H+ Sbjct: 190 VALIYFALCWPLSKSSQILERKLNVAHR 217 Lambda K H 0.330 0.145 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 219 Length adjustment: 26 Effective length of query: 358 Effective length of database: 193 Effective search space: 69094 Effective search space used: 69094 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory