Align HutW aka HISW, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate AZOBR_RS23475 AZOBR_RS23475 glycine betaine transporter subunit ; membrane component of ABC superfamily
Query= TCDB::Q9KKE2 (285 letters) >FitnessBrowser__azobra:AZOBR_RS23475 Length = 312 Score = 263 bits (671), Expect = 5e-75 Identities = 138/274 (50%), Positives = 188/274 (68%), Gaps = 5/274 (1%) Query: 8 LSIRAPVNDFIQA----LVTNYGWVFKAISGVILKAVLFIEWILRGLPWWLVILAFMALA 63 + + P+ D+ A L+ + W+F I V+ ++ L LP + + A + L Sbjct: 1 MDFKLPIGDWADAAVMFLLDHAQWLFDGIDLVVGAVADGVQAALTALPG-VALAAIVVLI 59 Query: 64 CRSSRRWSLTLAVCALLETVGVLGIWDLTMQTLALMLMATIVSVVIGVPMGILVAKSRVV 123 W L A L V LG+W T+ TLAL+L AT +++ IGVP+GI+ A++ V Sbjct: 60 GLWRNGWRFALFAAAALMVVAGLGMWHQTVDTLALVLTATAIALTIGVPLGIVAARNDRV 119 Query: 124 RNITLPVLDVMQTMPSFVYLIPALMLFGLGKVPAILATIIYAVPPLIRLTDLGIRQVDAE 183 + P LD+MQTMP+FVYLIPA MLFGLG+VP I+ATII+A+PP++RLT LGIRQV E Sbjct: 120 ETVVRPALDLMQTMPAFVYLIPAAMLFGLGRVPGIIATIIFAMPPVVRLTSLGIRQVPHE 179 Query: 184 VVEAATAFGGSPGQILFGVELPLATPTIMAGLNQTIMMALSMVVVASMIGARGLGEQVLN 243 +VEA AFG +P Q+LF V++P A P+IMAG+NQTIM++LSMVV+ASMIGA G+G +VL Sbjct: 180 LVEAGLAFGCTPRQLLFKVQMPTALPSIMAGINQTIMLSLSMVVIASMIGAGGVGNEVLR 239 Query: 244 GIQTLDVGKGLEAGIGIVILAVVLDRITQGFGKP 277 GIQ LD+G G+E G+ +VILA++LDRITQ FG P Sbjct: 240 GIQRLDIGLGVEGGLAVVILAILLDRITQSFGTP 273 Lambda K H 0.327 0.142 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 312 Length adjustment: 27 Effective length of query: 258 Effective length of database: 285 Effective search space: 73530 Effective search space used: 73530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory