Align Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)
to candidate AZOBR_RS08840 AZOBR_RS08840 ABC transporter ATP-binding protein
Query= SwissProt::P17328 (400 letters) >FitnessBrowser__azobra:AZOBR_RS08840 Length = 387 Score = 180 bits (457), Expect = 5e-50 Identities = 99/239 (41%), Positives = 143/239 (59%), Gaps = 6/239 (2%) Query: 32 EQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVD 91 E++ + G + V + SL+I GE F ++G SGSGK+T++R+L PT G++ IDGVD Sbjct: 27 EKVTKTFGDFVAVDEVSLSIYRGEFFALLGGSGSGKTTLLRMLAGFETPTEGKIFIDGVD 86 Query: 92 IAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQ 151 +A I E + + M+FQS+AL PHM+V N AFG++ G+A E +E+ L Sbjct: 87 MAGIPPYE------RPVNMMFQSYALFPHMSVEQNVAFGLKQDGVAKAEIKERVGAILDL 140 Query: 152 VGLENYAHAYPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQ 211 V L + P +LSGG RQRV LAR+L P +LL+DE ALD +R Q ELV +Q Sbjct: 141 VQLGQFGKRKPHQLSGGQRQRVALARSLVKRPKLLLLDEPLGALDKRLRERTQFELVNIQ 200 Query: 212 AKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGVDI 270 K T + ++HD +EAM + RIA+M +G + Q GTP EI P + +V F V++ Sbjct: 201 EKLGVTFIVVTHDQEEAMTMSSRIAVMNHGVIAQTGTPTEIYEYPQSRFVAEFIGSVNM 259 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 356 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 387 Length adjustment: 31 Effective length of query: 369 Effective length of database: 356 Effective search space: 131364 Effective search space used: 131364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory